[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Streptomyces avermitilis MA-4680 (save0)
Gene : BAC68164.1
DDBJ      :             hypothetical protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  6/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
:384 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:RPS:PDB   9->115 2dhhA PDBj 5e-08 17.8 %
:HMM:PFM   323->362 PF05661 * DUF808 0.00016 30.8 39/295  
:HMM:PFM   90->147 PF10431 * ClpB_D2-small 0.001 27.6 58/89  
:TM
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID BAC68164.1 GT:GENE BAC68164.1 GT:PRODUCT hypothetical protein GT:DATABASE GIB00135CH01 GT:ORG save0 GB:ACCESSION GIB00135CH01 GB:LOCATION 606685..607839 GB:FROM 606685 GB:TO 607839 GB:DIRECTION + GB:PRODUCT hypothetical protein GB:NOTE PF02366: Dolichyl-phosphate-mannose-protein mannosyltransferase GB:PROTEIN_ID BAC68164.1 LENGTH 384 SQ:AASEQ MIMTADVPETSSGRSVRVALVADPGLPSEIARALAPRLPDHLRRAVGARVRWQVDTMTAPLSVSEQADVSDIAEAVRSHLDGAEWDVAIFLTDFPRRARLYPISVEVDTALRAALISLPALGVRRLRRRVRQAVVDVVRELVAHEETPRHPEVIGRPPREPVPDTRPGPEQPQRYVVPGLRGHTRLVAGMVYANRPWRLFGSLSRALAGVFATATVLFINSATWNLATALGAVQHAVITAGSAVALTLWIIVDHQLWERGTHLPARHHPLYPYNLVTLVTIALAVVVLAAALFATLVAVSFLLLDASVLRKFIGRQVGVGDYLFLAWFITAIAMIGGAFGTSLEGDEKVSDAAYGRRQRERQRMLRQMPRPERGERRGPDTTDG GT:EXON 1|1-384:0| TM:NTM 4 TM:REGION 198->220| TM:REGION 230->252| TM:REGION 279->301| TM:REGION 319->341| SEG 120->143|algvrrlrrrvrqavvdvvrelva| SEG 275->304|lvtlvtialavvvlaaalfatlvavsflll| SEG 356->379|rrqrerqrmlrqmprpergerrgp| RP:PDB:NREP 1 RP:PDB:REP 9->115|2dhhA|5e-08|17.8|101/1022| HM:PFM:NREP 2 HM:PFM:REP 323->362|PF05661|0.00016|30.8|39/295|DUF808| HM:PFM:REP 90->147|PF10431|0.001|27.6|58/89|ClpB_D2-small| OP:NHOMO 9 OP:NHOMOORG 6 OP:PATTERN -------------------------------------------------------------------- --------------------------------------2--------------------------122---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------11-------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 101 STR:RPRED 26.3 SQ:SECSTR ########cccccEEEEEEccccccTTHHHHHHHHHHHHccGGGccccEEcccccEEcccccccHHHcHHHHHHHHHHHHHccc######ccEEEccccEEEccccccGGGcccT############################################################################################################################################################################################################################################################################# DISOP:02AL 1-5, 151-164, 356-384| PSIPRED ccEEccccccccccEEEEEEEEcccHHHHHHHHHHHHHHHHHHHHHcccEEEEEEEEEEcccccccccHHHHHHHHHHHHHHccccEEEEEEccccccccEEEEEEEcHHHcEEEEEEcccccHHHHHHHHHHHHHHHHHHHHcccccccccccccccccccccccccccccEEEEEEHHHHHHHHHHHHHHccccHHHHHHHHHHHHHHHHHHHHHHHHccHHHHHHHHcccccEEEcccHHHHHHHHHHHHHHHHHccccccccccccEEEcHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccHHHHHHHHHHHHHHHHHHHHHccccccHHHHHHHHHHHHHHHHHHHHHHcccHHHHHHcccccccc //