[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Streptomyces avermitilis MA-4680 (save0)
Gene : BAC68166.1
DDBJ      :             hypothetical protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  1/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
c.69.1
:213 amino acids
:PSIPRED
:DISOPRED
:RPS:SCOP  99->210 1uswA  c.69.1.17 * 2e-04 20.7 %
:HMM:PFM   101->151 PF00975 * Thioesterase 0.00068 21.6 51/229  
:BLT:SWISS 95->173 Y4KF_RHISN 9e-05 39.2 %
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID BAC68166.1 GT:GENE BAC68166.1 GT:PRODUCT hypothetical protein GT:DATABASE GIB00135CH01 GT:ORG save0 GB:ACCESSION GIB00135CH01 GB:LOCATION 608423..609064 GB:FROM 608423 GB:TO 609064 GB:DIRECTION + GB:PRODUCT hypothetical protein GB:PROTEIN_ID BAC68166.1 LENGTH 213 SQ:AASEQ MATLLRRVCPHEGVRIAAVPAGFVLSRRPWTASVYRCAVVGPQSEDRREVEGSRTPVASASSRLRPCRRRLSVVRCPRRAVPSQAVRSRFRPGTTRFLGDVLVYQRHRDALHARVRHVIDDVHPGLGRGAARPVRIATHSLGGVIAVDMATANVPLWTESLVTFGSQATFFHQPVPGDLLCQMIAFRMRKHQEAETGALPPETGFIAHAGQGW GT:EXON 1|1-213:0| BL:SWS:NREP 1 BL:SWS:REP 95->173|Y4KF_RHISN|9e-05|39.2|79/100| SEG 58->79|asassrlrpcrrrlsvvrcprr| HM:PFM:NREP 1 HM:PFM:REP 101->151|PF00975|0.00068|21.6|51/229|Thioesterase| RP:SCP:NREP 1 RP:SCP:REP 99->210|1uswA|2e-04|20.7|111/260|c.69.1.17| OP:NHOMO 1 OP:NHOMOORG 1 OP:PATTERN -------------------------------------------------------------------- -------------------------------------------------------------------1------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 43-60, 194-196| PSIPRED cHHHHHHHccccccEEEEEcccHHcccccccHHHEEEEEEcccccHHHHHcccccccHHHHHHHHHHHHHHHHHHccHHcccHHHHHHHccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccccccccccEEEEEcHHHHHHHHHHHHHHHHHHHHHHHHHcccccEEEccccHHHHHHHHHHHHHHHccHHcccccccccEEEcccccc //