[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Streptomyces avermitilis MA-4680 (save0)
Gene : BAC68172.1
DDBJ      :             hypothetical protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  1/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
:104 amino acids
:PSIPRED
:DISOPRED
:HMM:PFM   55->94 PF06707 * DUF1194 0.00043 7.5 40/206  

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID BAC68172.1 GT:GENE BAC68172.1 GT:PRODUCT hypothetical protein GT:DATABASE GIB00135CH01 GT:ORG save0 GB:ACCESSION GIB00135CH01 GB:LOCATION complement(614386..614700) GB:FROM 614386 GB:TO 614700 GB:DIRECTION - GB:PRODUCT hypothetical protein GB:PROTEIN_ID BAC68172.1 LENGTH 104 SQ:AASEQ MTTENCRRDLTAICKAADSGYLLQVIRDGSFEPLAQKDLSHWPDWPTFPVDAAHAAGCELVMLGYMIWPDTVTPDSLIGWRAVPDQQAWSAKVGTFAQLQAAGI GT:EXON 1|1-104:0| HM:PFM:NREP 1 HM:PFM:REP 55->94|PF06707|0.00043|7.5|40/206|DUF1194| OP:NHOMO 2 OP:NHOMOORG 1 OP:PATTERN -------------------------------------------------------------------- -------------------------------------------------------------------2------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 1-5| PSIPRED cccHHHHHHHHHHHHcccccEEEEEEcccccccHHHHHHHcccccccccccccccccccEEEHHHHHcccccccccccccccccccccHHcccccHHHHHcccc //