[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Streptomyces avermitilis MA-4680 (save0)
Gene : BAC68176.1
DDBJ      :             hypothetical protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  1/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
:179 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:RPS:PDB   73->118 3cbrB PDBj 2e-04 23.9 %
:HMM:PFM   63->111 PF11974 * MG1 0.00021 26.5 49/95  
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID BAC68176.1 GT:GENE BAC68176.1 GT:PRODUCT hypothetical protein GT:DATABASE GIB00135CH01 GT:ORG save0 GB:ACCESSION GIB00135CH01 GB:LOCATION 618189..618728 GB:FROM 618189 GB:TO 618728 GB:DIRECTION + GB:PRODUCT hypothetical protein GB:PROTEIN_ID BAC68176.1 LENGTH 179 SQ:AASEQ MRSSGRMAVSAMAVAMAALGVGSGAPASAAPTATPSCSGTECLSLKPTRLTASQASLNVTQMQLENINAMASDAVTGEPIRGAKIVFATTGGRTLGTAYTDYDGIAAIAAPENLGPGTLQELLGGYEAAMVGDGVHAPAGAHGAITIGTDQGPGVPGSPCAVCSDRALKQDVVPVDWSR GT:EXON 1|1-179:0| SEG 1->40|mrssgrmavsamavamaalgvgsgapasaaptatpscsgt| RP:PDB:NREP 1 RP:PDB:REP 73->118|3cbrB|2e-04|23.9|46/97| HM:PFM:NREP 1 HM:PFM:REP 63->111|PF11974|0.00021|26.5|49/95|MG1| OP:NHOMO 1 OP:NHOMOORG 1 OP:PATTERN -------------------------------------------------------------------- -------------------------------------------------------------------1------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 74 STR:RPRED 41.3 SQ:SECSTR ########################################################################ETTTTEEccccEEEEEEcccEEEEEEEccTTcEcccccTTTcccEEEEEcHHHHHHHTTcccccccEEEEEEEc################################# DISOP:02AL 1-9| PSIPRED cccccHHHHHHHHHHHHHHcccccccccccccccccccccEEEEccccEEEcccccccHHHHHHHHccHHHccccccccccccEEEEEEccccEEccEEcccccEEEEEcccccccHHHHHHHccccEEEEccccccccccccEEEEEccccccccccccHHHcccHHHHccccccccc //