[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Streptomyces avermitilis MA-4680 (save0)
Gene : BAC68179.1
DDBJ      :             putative secreted lipase
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  31/915 : Eukaryota  22/199 : Viruses  0/175   --->[See Alignment]
c.69.1
:401 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   86->379 3f98A PDBj 3e-09 28.0 %
:RPS:PDB   135->311 1bcrA PDBj 5e-07 9.9 %
:RPS:SCOP  135->313 1bcr.1  c.69.1.5 * 2e-07 9.8 %
:HMM:SCOP  59->382 1jfrA_ c.69.1.16 * 8.9e-20 23.5 %
:RPS:PFM   126->338 PF03403 * PAF-AH_p_II 4e-12 32.8 %
:HMM:PFM   47->177 PF03403 * PAF-AH_p_II 3e-08 28.6 119/381  
:HMM:PFM   236->382 PF03403 * PAF-AH_p_II 4.8e-09 27.3 139/381  
:BLT:SWISS 86->379 PAFA_CAVPO 2e-12 29.2 %
:TM
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID BAC68179.1 GT:GENE BAC68179.1 GT:PRODUCT putative secreted lipase GT:DATABASE GIB00135CH01 GT:ORG save0 GB:ACCESSION GIB00135CH01 GB:LOCATION 620530..621735 GB:FROM 620530 GB:TO 621735 GB:DIRECTION + GB:PRODUCT putative secreted lipase GB:NOTE PF03403: Platelet-activating factor acetylhydrolase, plasma/intracellular isoform II GB:PROTEIN_ID BAC68179.1 LENGTH 401 SQ:AASEQ MTTTPFISRKGMTRRSMLGAALAAVPLAAVAGPAWADPAAPAVTRLMLPVPTGPHPVGTVQLHLVDRSRPDDIAGPGHFRELMATVWYPARDVQRYPVAPWMPAGALQAFLADAGFSALVRLGPLTAGHVGAPVRRSGRRLPVVVFSHGAHSHQGDHTVMVQELASHGYAAVTVAHQYDTYTEFPDGRIAVPLHDGQAPTLPGDFAADLRFVLDCVEQLAAGCNPDVDHRELPAGLLGSLDPRRVGAFGWSKGGTATACATLADERIRAGLSLDGPMQMNPPLAGDLDRPFMMMSAVFTRATDPEAAAFWSHLRGWRLNIQAQGAVHVSYGDNEALFPQVAKLLGWSGQQLQDVIGTLDPDQAVKIQQAYPLAFFDEHLRHRRGHLLDGPSPAFPAVTFLP GT:EXON 1|1-401:0| BL:SWS:NREP 1 BL:SWS:REP 86->379|PAFA_CAVPO|2e-12|29.2|277/436| TM:NTM 1 TM:REGION 16->38| SEG 18->43|lgaalaavplaavagpawadpaapav| SEG 49->60|pvptgphpvgtv| BL:PDB:NREP 1 BL:PDB:REP 86->379|3f98A|3e-09|28.0|282/377| RP:PDB:NREP 1 RP:PDB:REP 135->311|1bcrA|5e-07|9.9|172/254| RP:PFM:NREP 1 RP:PFM:REP 126->338|PF03403|4e-12|32.8|189/216|PAF-AH_p_II| HM:PFM:NREP 2 HM:PFM:REP 47->177|PF03403|3e-08|28.6|119/381|PAF-AH_p_II| HM:PFM:REP 236->382|PF03403|4.8e-09|27.3|139/381|PAF-AH_p_II| GO:PFM:NREP 2 GO:PFM GO:0003847|"GO:1-alkyl-2-acetylglycerophosphocholine esterase activity"|PF03403|IPR005065| GO:PFM GO:0016042|"GO:lipid catabolic process"|PF03403|IPR005065| RP:SCP:NREP 1 RP:SCP:REP 135->313|1bcr.1|2e-07|9.8|174/407|c.69.1.5| HM:SCP:REP 59->382|1jfrA_|8.9e-20|23.5|255/260|c.69.1.16|1/1|alpha/beta-Hydrolases| OP:NHOMO 69 OP:NHOMOORG 53 OP:PATTERN -------------------------------------------------------------------- ----3--------------------1----------3------------------------------221----------------------------------------------------------------------------------------------------------------------------1111121--11111111----11----1------------------------------------------------------------------------------------------------------------------1-2---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1--------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1111-------------------------------------------------------------------------------------------------------------- ---------------1-2--1111111------1------------1-112223-11---------------------------------------------------------------------------------------------------------------------------1----1---2--------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 310 STR:RPRED 77.3 SQ:SECSTR ############################################################################cEEEEcccccccGGGcccccTTcccccEEEEEEccEEEEEEEEETTTTEEEEEEEEcccGGGccccEEEEEccTTTccTTTTHHHHTcccEEEcGGGccEEEcTTcGGGTcEEEEEcccTTEccGGcTTcccccGGGGGTccHHHHHHHHHHHHHHHHHHcGGGTTcEEEEEEETTHHHHHHHHHHHHHHTccccEEEEEEEEcccccHHHHHHHHHHHHHTTTcccHHHHHHHHHHHHTTcEEEEEHHHHHTTccHHHHHTccccccTTccccccccccccccccHHHHHHTTcccccEEEEEEETTHH############### DISOP:02AL 1-2, 395-397| PSIPRED ccccccccccccHHHHHHHHHHHHHHHHHHccccccccccccccccccccccccccccEEEEEEEccccccccccccccEEEEEEEEccccccccccccccccHHHHHHHHcccccEEEEccccEEccccccccccccccccEEEEEccccccHHHHHHHHHHHHHccEEEEEEEccccccEEcccccccccccccccHHHHHHHHHHHHHHHHHHHHHHHHcccccccccccHHHHcccccccEEEEEEcHHHHHHHHHHHccccEEEEEEccccccccccccccccccEEEEcccccccccHHHHHHHHHccccccEEEEcccccccccccHHccccHHHHccccHHHHHcccccccHHHHHHHHHHHHHHHHHHHHccccccccccccccccccEEcc //