[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Streptomyces avermitilis MA-4680 (save0)
Gene : BAC68181.1
DDBJ      :             hypothetical protein
Swiss-Prot:             

Homologs  Archaea  1/68 : Bacteria  84/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
c.71.1
:188 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   2->184 2gd9A PDBj 2e-12 31.5 %
:RPS:PDB   2->188 2aznA PDBj 9e-17 15.4 %
:RPS:SCOP  1->121 1juvA  c.71.1.1 * 1e-19 7.8 %
:HMM:SCOP  1->188 8dfrA_ c.71.1.1 * 8.6e-34 34.5 %
:HMM:PFM   2->181 PF01872 * RibD_C 1.1e-26 32.5 169/200  
:BLT:SWISS 2->184 YYAP_BACSU 8e-16 29.0 %
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID BAC68181.1 GT:GENE BAC68181.1 GT:PRODUCT hypothetical protein GT:DATABASE GIB00135CH01 GT:ORG save0 GB:ACCESSION GIB00135CH01 GB:LOCATION 622993..623559 GB:FROM 622993 GB:TO 623559 GB:DIRECTION + GB:PRODUCT hypothetical protein GB:NOTE PF01872: RibD C-terminal domain GB:PROTEIN_ID BAC68181.1 LENGTH 188 SQ:AASEQ MRKLIYGMNLTLDGYIAAAGDDIGWSGPPSDELFQWWLDQERAISLLLYGRKLWETMSAYWPTGDQQPNATPAEIEFARNWRDTPKVVFSSTVDKVDWNTRLVSGDAVAEITRLKAEDGGPMRVGGAALAGAAMRAGLIDEYAIVTHPVLVGSGTPFFTALDSWASLNLVETRTFPGGVVLTRYETRR GT:EXON 1|1-188:0| BL:SWS:NREP 1 BL:SWS:REP 2->184|YYAP_BACSU|8e-16|29.0|176/188| SEG 122->138|mrvggaalagaamragl| BL:PDB:NREP 1 BL:PDB:REP 2->184|2gd9A|2e-12|31.5|162/173| RP:PDB:NREP 1 RP:PDB:REP 2->188|2aznA|9e-17|15.4|182/214| HM:PFM:NREP 1 HM:PFM:REP 2->181|PF01872|1.1e-26|32.5|169/200|RibD_C| RP:SCP:NREP 1 RP:SCP:REP 1->121|1juvA|1e-19|7.8|116/193|c.71.1.1| HM:SCP:REP 1->188|8dfrA_|8.6e-34|34.5|168/0|c.71.1.1|1/1|Dihydrofolate reductase-like| OP:NHOMO 156 OP:NHOMOORG 85 OP:PATTERN --------------------------------------------1----------------------- -11-2--2-------------2---1-------1113432-2-2-6---1--211--2--122-2-3222-----------------------------1-1---435-3---------------------------22-1---2---------------------------------------1--------------1----1-1-1-----1------11-1------11-------------------1--------------------------------------------------------------------------1---------------------------------------------1-----1--------11------------------1---------231-1---232223-1---1-----------------------------------------------------------1-------------------------------------------------------------------------1-----------------------332433----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------11-------------------------------------------------------------------33--22-----------------------------------------------1- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 188 STR:RPRED 100.0 SQ:SECSTR cccEEEEEEEETTcccccTTcccccccHHHHHHHHHHHHHHHHTccEEEEHHHHHHHcccccccccccccccTTccccTTcGTccEEEEEccccccEEEEcccccccHHHHHHHHHTTccEEEEEEcHHHHHHHHTTcccEEEEEEEcccccccccccccGGGcccEEEEEEEEETTEEEEEEEEEcc DISOP:02AL 188-189| PSIPRED ccEEEEEEEEccccEEEccccccccccccHHHHHHHHHHHHHcccEEEEEccHHccccccccccccccccccccEEEccccccccEEEEccccccccccEEEEcccHHHHHHHHHHccccEEEEccHHHHHHHHHcccccEEEEEEEEEEEcccccccccccccccEEEEEEEEccccEEEEEEEEcc //