[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Streptomyces avermitilis MA-4680 (save0)
Gene : BAC68186.1
DDBJ      :             hypothetical protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  50/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
d.32.1
:188 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   49->187 1ss4B PDBj 6e-37 59.7 %
:RPS:PDB   4->185 1cjxA PDBj 7e-12 12.1 %
:RPS:SCOP  45->187 1ss4A  d.32.1.6 * 3e-16 54.9 %
:HMM:SCOP  43->185 1ss4A_ d.32.1.6 * 1.4e-30 35.2 %
:RPS:PFM   47->181 PF00903 * Glyoxalase 4e-07 37.7 %
:HMM:PFM   48->181 PF00903 * Glyoxalase 6.3e-10 28.3 120/128  
:BLT:SWISS 46->178 YWBC_BACSU 1e-06 32.7 %

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID BAC68186.1 GT:GENE BAC68186.1 GT:PRODUCT hypothetical protein GT:DATABASE GIB00135CH01 GT:ORG save0 GB:ACCESSION GIB00135CH01 GB:LOCATION complement(627541..628107) GB:FROM 627541 GB:TO 628107 GB:DIRECTION - GB:PRODUCT hypothetical protein GB:NOTE PF00903: Glyoxalase/Bleomycin resistance protein/Dioxygenase superfamily GB:PROTEIN_ID BAC68186.1 LENGTH 188 SQ:AASEQ MLRRDPDFSEFGGLTMSRTCHWLRPRDSSGHHRPHKEEGETCMAIQRMDNVGIVVEDLDAAIAFFVELGMELEGRAEVEGLFADQCTGLDGVRCDIAMVRTPDGHSRLELAKYRSPAVISAGPRNRPHNILGTHRVMFAVDDIEDTVARLRPHGAELVGEIARFEDSYLLCYLRGPEGIIVGLAEQLR GT:EXON 1|1-188:0| BL:SWS:NREP 1 BL:SWS:REP 46->178|YWBC_BACSU|1e-06|32.7|113/100| BL:PDB:NREP 1 BL:PDB:REP 49->187|1ss4B|6e-37|59.7|134/140| RP:PDB:NREP 1 RP:PDB:REP 4->185|1cjxA|7e-12|12.1|174/352| RP:PFM:NREP 1 RP:PFM:REP 47->181|PF00903|4e-07|37.7|114/120|Glyoxalase| HM:PFM:NREP 1 HM:PFM:REP 48->181|PF00903|6.3e-10|28.3|120/128|Glyoxalase| RP:SCP:NREP 1 RP:SCP:REP 45->187|1ss4A|3e-16|54.9|142/149|d.32.1.6| HM:SCP:REP 43->185|1ss4A_|1.4e-30|35.2|142/149|d.32.1.6|1/1|Glyoxalase/Bleomycin resistance protein/Dihydroxybiphenyl dioxygenase| OP:NHOMO 54 OP:NHOMOORG 50 OP:PATTERN -------------------------------------------------------------------- ----2---111-------------1------1-----112-----------1111--1---------11----------------------------------------1----------------------------------1----1--------------------------------------------11111111-11111---------1---111-------11------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1------2--121-1-------------------------------------------------------------------------------------1-------------------------1-1--------------------------------------------1---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------11----------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 184 STR:RPRED 97.9 SQ:SECSTR ###EcGGGcEEEEEccccccccHHHHHEEEcTTccccccTTcEEEEEEEcEEccTTHHHHHHHHHHHHHccEGGGGGccEEEEEEEEEccccEEEEEEEEcTTcccEEEEEEEcTTcccHHHHHHHHHTcccccEEEEEEccHHHHHHHHHHTTccccccccHHHHHTHHHHcTTccccHHHHHHEc# DISOP:02AL 1-6, 32-33| PSIPRED cccccccHHHHccEEEccEEEEEcccccccccccccccccccccccEEEEEEEEcccHHHHHHHHHHcccEEEEEccccccccHHcccccccEEEEEEEEcccccEEEEEEcccccccccccccccccccccEEEEEEEEccHHHHHHHHHHcccEEEEcEEcccccEEEEEEEcccccEEEEEEEcc //