[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Streptomyces avermitilis MA-4680 (save0)
Gene : BAC68188.1
DDBJ      :             hypothetical protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  2/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
c.108.1
:105 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   31->80 2b0cA PDBj 2e-05 38.8 %
:RPS:PDB   1->92 3ed5A PDBj 1e-06 9.8 %
:RPS:SCOP  29->89 1cqzB1  c.108.1.2 * 2e-12 26.7 %
:HMM:SCOP  1->92 1vj5A1 c.108.1.2 * 4.7e-11 33.0 %
:BLT:SWISS 29->89 ACD10_HUMAN 2e-06 38.3 %

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID BAC68188.1 GT:GENE BAC68188.1 GT:PRODUCT hypothetical protein GT:DATABASE GIB00135CH01 GT:ORG save0 GB:ACCESSION GIB00135CH01 GB:LOCATION 629473..629790 GB:FROM 629473 GB:TO 629790 GB:DIRECTION + GB:PRODUCT hypothetical protein GB:PROTEIN_ID BAC68188.1 LENGTH 105 SQ:AASEQ MTLLSNVPHPLAEALDLSAWCSTLMTRTVYSARLGVNKPDPRAYEAAVVAAGLPHPENTLFVDDRLENCAVAAQLGLRTLHFNGDSQALASHIPQMVPATGIRRN GT:EXON 1|1-105:0| BL:SWS:NREP 1 BL:SWS:REP 29->89|ACD10_HUMAN|2e-06|38.3|60/1059| BL:PDB:NREP 1 BL:PDB:REP 31->80|2b0cA|2e-05|38.8|49/199| RP:PDB:NREP 1 RP:PDB:REP 1->92|3ed5A|1e-06|9.8|92/226| RP:SCP:NREP 1 RP:SCP:REP 29->89|1cqzB1|2e-12|26.7|60/222|c.108.1.2| HM:SCP:REP 1->92|1vj5A1|4.7e-11|33.0|91/226|c.108.1.2|1/1|HAD-like| OP:NHOMO 2 OP:NHOMOORG 2 OP:PATTERN -------------------------------------------------------------------- -------------------------------------------------------------------11------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------ ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 97 STR:RPRED 92.4 SQ:SECSTR EEEEEcccHHHHHHHHHHTTcGGGccEEEEGGGTTccTTHHHHHHHHHTcTTccGGGEEEEEccTTTTHHHHHHTTcEEEEcTTcccTTcccTccEE######## DISOP:02AL 103-105| PSIPRED cEEEEcccHHHHHHHHHHccHHHcccEEEEEcccccccccHHHHHHHHHHccccccHHEEEEcccHHHHHHHHHcccEEEEEEccccccHHHHHHHHHHHccccc //