[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Streptomyces avermitilis MA-4680 (save0)
Gene : BAC68189.1
DDBJ      :             putative IS630 family ISPlu10-like transposase
Swiss-Prot:             

Homologs  Archaea  1/68 : Bacteria  11/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
:182 amino acids
:PSIPRED
:DISOPRED
:HMM:PFM   69->131 PF00665 * rve 4.3e-06 27.4 62/120  
:BLT:SWISS 79->141 Y4PE_RHISN 2e-05 40.7 %

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID BAC68189.1 GT:GENE BAC68189.1 GT:PRODUCT putative IS630 family ISPlu10-like transposase GT:DATABASE GIB00135CH01 GT:ORG save0 GB:ACCESSION GIB00135CH01 GB:LOCATION complement(629806..630354) GB:FROM 629806 GB:TO 630354 GB:DIRECTION - GB:PRODUCT putative IS630 family ISPlu10-like transposase GB:NOTE IS3 family (630954..629809) Inverted repeat seqnce (25/26 bp). Target sequence (TA); Translation will be controlled by framenshift with SAV480. GB:PROTEIN_ID BAC68189.1 LENGTH 182 SQ:AASEQ MTPPTSRTWARRGHTPVIRVRGRSQRRISIAALACYKQGERSRLVYRSKRHVDHKRGGRRSFAWTDYRDLLIAAHQQLGAPIVLGWDNLNVHKDRRLREFINAHDWINCFFLPTYAPDLNPVEGVWSLLRRSSQANTAFTDPGHLMRALRHGLRQIQYRNNLIDGCLAETGLTLTTKRQQAQ GT:EXON 1|1-182:0| BL:SWS:NREP 1 BL:SWS:REP 79->141|Y4PE_RHISN|2e-05|40.7|59/135| HM:PFM:NREP 1 HM:PFM:REP 69->131|PF00665|4.3e-06|27.4|62/120|rve| OP:NHOMO 30 OP:NHOMOORG 12 OP:PATTERN ------------------------------1------------------------------------- ----1------------------------------------158----------------------24--------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------2-----------------------------------------------------------------3----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------111--------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 179-182| PSIPRED cccccccccccccEEEEEEEEccccEEEEEEEEEEEccccEEEEEEccEEEEEEcccHHHHHHHHHHHHHHHHHccccccEEEEEEccccccccHHHHHHHHccccEEEEEEcccccccccHHHHHHHHHHHHHHccccccHHHHHHHHHHHHHHcccccHHHHHHHHHHHHHEEEcHHccc //