[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Streptomyces avermitilis MA-4680 (save0)
Gene : BAC68190.1
DDBJ      :             putative IS4 family ISXo14-like transposase
Swiss-Prot:             

Homologs  Archaea  1/68 : Bacteria  7/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
:111 amino acids
:PSIPRED
:DISOPRED
:HMM:PFM   38->59 PF04545 * Sigma70_r4 0.00075 27.3 22/50  

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID BAC68190.1 GT:GENE BAC68190.1 GT:PRODUCT putative IS4 family ISXo14-like transposase GT:DATABASE GIB00135CH01 GT:ORG save0 GB:ACCESSION GIB00135CH01 GB:LOCATION complement(630351..630686) GB:FROM 630351 GB:TO 630686 GB:DIRECTION - GB:PRODUCT putative IS4 family ISXo14-like transposase GB:NOTE IS3 family (630954..629809) Inverted repeat seqnce (25/26 bp). Target sequence (TA). GB:PROTEIN_ID BAC68190.1 LENGTH 111 SQ:AASEQ MSLPKLSEKLFTVLEQELGKGPVAHGWPDQTWTLSRIKTLIGRRFHKSMTLSAIAQMLHRHGFSHQVPARRAVERNEETVTGWVKETWPQVETPWRRSGPGSASKTRPVSR GT:EXON 1|1-111:0| HM:PFM:NREP 1 HM:PFM:REP 38->59|PF04545|0.00075|27.3|22/50|Sigma70_r4| OP:NHOMO 20 OP:NHOMOORG 8 OP:PATTERN ------------------------------1------------------------------------- ----1------------------------------------137----------------------24---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1--------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 1-2, 92-111| PSIPRED cccccccHHHHHHHHHHHccccHHHccccccccHHHHHHHHHHHccccccHHHHHHHHHHHccccccccHHHHHccHHHHHHHHHHHHHHHHHHHHHcccccccccccccc //