[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Streptomyces avermitilis MA-4680 (save0)
Gene : BAC68191.1
DDBJ      :             hypothetical protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  1/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
:107 amino acids
:PSIPRED
:DISOPRED
:HMM:PFM   36->85 PF05441 * Micro_A_star 0.00025 24.0 50/341  

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID BAC68191.1 GT:GENE BAC68191.1 GT:PRODUCT hypothetical protein GT:DATABASE GIB00135CH01 GT:ORG save0 GB:ACCESSION GIB00135CH01 GB:LOCATION complement(630951..631274) GB:FROM 630951 GB:TO 631274 GB:DIRECTION - GB:PRODUCT hypothetical protein GB:PROTEIN_ID BAC68191.1 LENGTH 107 SQ:AASEQ MYDGTPGSGGGNAHWPATGYYATTTRDCEDINLKVNATRSVRTCFKATGSCNAWSTARAKQWALAATDVSDGSDFYIQFSGTAKSTGYIAYREEDGMNHLATPDDCY GT:EXON 1|1-107:0| HM:PFM:NREP 1 HM:PFM:REP 36->85|PF05441|0.00025|24.0|50/341|Micro_A_star| OP:NHOMO 1 OP:NHOMOORG 1 OP:PATTERN -------------------------------------------------------------------- -------------------------------------------------------------------1------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 1-7, 105-106| PSIPRED cccccccccccccccccccEEEEcccccccEEEEEEccHHHHHHHHccccccccccccccEEEEEEcccccccEEEEEEccccccccEEEEEccccccccccccccc //