Streptomyces avermitilis MA-4680 (save0)
Gene : BAC68192.1
DDBJ      :             hypothetical protein

Homologs  Archaea  0/68 : Bacteria  1/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
:105 amino acids
:HMM:PFM   5->35 PF11233 * DUF3035 0.00087 33.3 30/157  

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID BAC68192.1 GT:GENE BAC68192.1 GT:PRODUCT hypothetical protein GT:DATABASE GIB00135CH01 GT:ORG save0 GB:ACCESSION GIB00135CH01 GB:LOCATION 631222..631539 GB:FROM 631222 GB:TO 631539 GB:DIRECTION + GB:PRODUCT hypothetical protein GB:PROTEIN_ID BAC68192.1 LENGTH 105 SQ:AASEQ MAGQCALPPPLPGVPSYKNAVSRQAARRSLPGSPSTPWRCWRPHRRGHCRRWSSTGTHDYVVVFDADTDAVPVFTALGRWVGMAESSGTIGTLTEIHERVNGGDA GT:EXON 1|1-105:0| HM:PFM:NREP 1 HM:PFM:REP 5->35|PF11233|0.00087|33.3|30/157|DUF3035| OP:NHOMO 1 OP:NHOMOORG 1 OP:PATTERN -------------------------------------------------------------------- -------------------------------------------------------------------1------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 1-6, 21-33, 102-105| PSIPRED ccccccccccccccccHHHHHHHHHHHHcccccccccccccccccccccccccccccccEEEEEEcccccccHHHHHHHHcccccccccHHHHHHHHHHHccccc //