[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Streptomyces avermitilis MA-4680 (save0)
Gene : BAC68193.1
DDBJ      :             hypothetical protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  1/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
:73 amino acids
:PSIPRED
:DISOPRED
:HMM:PFM   46->62 PF01405 * PsbT 0.00022 41.2 17/29  
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID BAC68193.1 GT:GENE BAC68193.1 GT:PRODUCT hypothetical protein GT:DATABASE GIB00135CH01 GT:ORG save0 GB:ACCESSION GIB00135CH01 GB:LOCATION complement(631562..631783) GB:FROM 631562 GB:TO 631783 GB:DIRECTION - GB:PRODUCT hypothetical protein GB:PROTEIN_ID BAC68193.1 LENGTH 73 SQ:AASEQ MVSKRRSAAPGRGSRAAVLGMVLPASDVGDHEELVAAEVHHHPGVRALGVLVGGVLFRTPPRGPPAGNRSRTV GT:EXON 1|1-73:0| SEG 5->17|rrsaapgrgsraa| SEG 31->42|heelvaaevhhh| SEG 48->56|lgvlvggvl| HM:PFM:NREP 1 HM:PFM:REP 46->62|PF01405|0.00022|41.2|17/29|PsbT| OP:NHOMO 1 OP:NHOMOORG 1 OP:PATTERN -------------------------------------------------------------------- -------------------------------------------------------------------1------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 1-14, 62-73| PSIPRED cccccccccccccccEEEEEEEccccccccHHHHHHHHHcccccHHHHHHHHHHHHHcccccccccccccccc //