[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Streptomyces avermitilis MA-4680 (save0)
Gene : BAC68195.1
DDBJ      :             hypothetical protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  1/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
:103 amino acids
:PSIPRED
:DISOPRED
:HMM:PFM   28->53 PF12131 * DUF3586 0.00015 42.3 26/78  
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID BAC68195.1 GT:GENE BAC68195.1 GT:PRODUCT hypothetical protein GT:DATABASE GIB00135CH01 GT:ORG save0 GB:ACCESSION GIB00135CH01 GB:LOCATION 632948..633259 GB:FROM 632948 GB:TO 633259 GB:DIRECTION + GB:PRODUCT hypothetical protein GB:PROTEIN_ID BAC68195.1 LENGTH 103 SQ:AASEQ MPAGRPSTENPAVPQPPPTPSLPRREPLHDGQTTQLTCLRTRVLATAYSSSDCWTQRTASSPTRPWQRSPAVTLPQPSPRRVPAGPGDAPQHPDPGRGRGSRN GT:EXON 1|1-103:0| SEG 11->27|pavpqppptpslprrep| HM:PFM:NREP 1 HM:PFM:REP 28->53|PF12131|0.00015|42.3|26/78|DUF3586| OP:NHOMO 1 OP:NHOMOORG 1 OP:PATTERN -------------------------------------------------------------------- -------------------------------------------------------------------1------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 1-23, 78-103| PSIPRED cccccccccccccccccccccccccccccccccccHHHHHHHHHHHcccccccccccccccccccccccccEEcccccccccccccccccccccccccccccc //