[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Streptomyces avermitilis MA-4680 (save0)
Gene : BAC68196.1
DDBJ      :             hypothetical protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  1/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
:75 amino acids
:PSIPRED
:DISOPRED
:HMM:PFM   27->72 PF11913 * DUF3431 0.00022 24.4 45/223  

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID BAC68196.1 GT:GENE BAC68196.1 GT:PRODUCT hypothetical protein GT:DATABASE GIB00135CH01 GT:ORG save0 GB:ACCESSION GIB00135CH01 GB:LOCATION 633243..633470 GB:FROM 633243 GB:TO 633470 GB:DIRECTION + GB:PRODUCT hypothetical protein GB:PROTEIN_ID BAC68196.1 LENGTH 75 SQ:AASEQ MEAGIDTRTWEERHEEIRTYARDAYELPPQFDPATEVNRIRAYLYDNYPQIAAALAVFLHEMPPTWREDLFHHLP GT:EXON 1|1-75:0| HM:PFM:NREP 1 HM:PFM:REP 27->72|PF11913|0.00022|24.4|45/223|DUF3431| OP:NHOMO 1 OP:NHOMOORG 1 OP:PATTERN -------------------------------------------------------------------- -------------------------------------------------------------------1------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 1-3| PSIPRED cccccccccHHHHHHHHHHHHHHHHccccccccHHHHHHHHHHHHcccHHHHHHHHHHHHHccccHHHHHHHccc //