[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Streptomyces avermitilis MA-4680 (save0)
Gene : BAC68198.1
DDBJ      :             putative TetR-family transcriptional regulator
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  46/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
a.121.1a.4.1
:227 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   30->140 2vkeA PDBj 3e-13 37.8 %
:RPS:PDB   31->155 3b6aB PDBj 1e-11 35.2 %
:RPS:SCOP  31->78 2g7lA1  a.4.1.9 * 9e-07 47.9 %
:RPS:SCOP  76->192 1a6iA2  a.121.1.1 * 3e-13 26.2 %
:HMM:SCOP  14->80 2g7gA1 a.4.1.9 * 7.8e-11 33.8 %
:HMM:SCOP  80->222 1z0xA2 a.121.1.1 * 1.5e-30 34.3 %
:RPS:PFM   75->155 PF02909 * TetR_C 3e-07 33.3 %
:HMM:PFM   76->216 PF02909 * TetR_C 8.7e-17 23.9 134/139  
:HMM:PFM   20->63 PF00440 * TetR_N 1.9e-14 43.2 44/47  
:BLT:SWISS 30->140 TETR8_PASPI 1e-12 37.8 %
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID BAC68198.1 GT:GENE BAC68198.1 GT:PRODUCT putative TetR-family transcriptional regulator GT:DATABASE GIB00135CH01 GT:ORG save0 GB:ACCESSION GIB00135CH01 GB:LOCATION complement(634378..635061) GB:FROM 634378 GB:TO 635061 GB:DIRECTION - GB:PRODUCT putative TetR-family transcriptional regulator GB:NOTE PF00440: Bacterial regulatory proteins, tetR family GB:PROTEIN_ID BAC68198.1 LENGTH 227 SQ:AASEQ MTRQEATHTQRIPLNRDRVLRAAVALADATGIDALSMRRLAQELDVVPMALYKHVANKEELLDGMADAVVGEIDPPAAGPDWQRVVRGRILSARRVLLRHPWAARVIESRTGPTPAVLAYLDSMAGSFRDGGLSADLTHHVMHAMGSRLLGFSQELFDTSGPSGPPDPGLAARYPHIAELAATAAHDGGSTVGGGCDDQFEFEFALDLLLDGFESLRRQGWTSARKT GT:EXON 1|1-227:0| BL:SWS:NREP 1 BL:SWS:REP 30->140|TETR8_PASPI|1e-12|37.8|111/218| SEG 16->29|rdrvlraavalada| SEG 160->169|sgpsgppdpg| SEG 197->214|ddqfefefaldllldgfe| BL:PDB:NREP 1 BL:PDB:REP 30->140|2vkeA|3e-13|37.8|111/200| RP:PDB:NREP 1 RP:PDB:REP 31->155|3b6aB|1e-11|35.2|125/209| RP:PFM:NREP 1 RP:PFM:REP 75->155|PF02909|3e-07|33.3|81/140|TetR_C| HM:PFM:NREP 2 HM:PFM:REP 76->216|PF02909|8.7e-17|23.9|134/139|TetR_C| HM:PFM:REP 20->63|PF00440|1.9e-14|43.2|44/47|TetR_N| GO:PFM:NREP 2 GO:PFM GO:0016481|"GO:negative regulation of transcription"|PF02909|IPR004111| GO:PFM GO:0016566|"GO:specific transcriptional repressor activity"|PF02909|IPR004111| RP:SCP:NREP 2 RP:SCP:REP 31->78|2g7lA1|9e-07|47.9|48/68|a.4.1.9| RP:SCP:REP 76->192|1a6iA2|3e-13|26.2|103/127|a.121.1.1| HM:SCP:REP 14->80|2g7gA1|7.8e-11|33.8|65/0|a.4.1.9|1/1|Homeodomain-like| HM:SCP:REP 80->222|1z0xA2|1.5e-30|34.3|134/0|a.121.1.1|1/1|Tetracyclin repressor-like, C-terminal domain| OP:NHOMO 85 OP:NHOMOORG 46 OP:PATTERN -------------------------------------------------------------------- ----7-----------1--------2------2---6222-21416-------12-----221-2-4163-------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1-----------1-------------------------------------------------------------------------------------------------------------1---------------------------------------1-----1-1111111-----------------------------------------------------------------------111-11-------1-------1------------------------------------------------------------------------1--------------------------------------------------------------------------------------------------------------1-----------------------------------------------------------------------------------------------------------------------------------------------------11----------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 129 STR:RPRED 56.8 SQ:SECSTR #############################HcGGGccHHHHHHHTTccHHHHHHTTccHHHHHHHHHHHHGGGcccccccTcHHHHHHHHHHHHHHHHHHcTTHHHHHTTcccccHHHHHHHHHHHHHHHTTcccHHHHHHHHHHHHHHHHHHHHHHHT##################################################################### DISOP:02AL 1-18, 222-227| PSIPRED cccccccccccHHHHHHHHHHHHHHHHHHcccccccHHHHHHHHcccccccEEEcccHHHHHHHHHHHHHHHHHHHcccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccHHHHHHHHHHHHHHHHccccHHHHHHHHHHHHHHHHHHHHHHHHHccccccccHHHHHHHHHHHHHHHHHccccccHHccccccHHHHHHHHHHHHHHHHHHHHHcccccccc //