[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Streptomyces avermitilis MA-4680 (save0)
Gene : BAC68199.1
DDBJ      :             hypothetical protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  4/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
:239 amino acids
:PSIPRED
:DISOPRED
:TM
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID BAC68199.1 GT:GENE BAC68199.1 GT:PRODUCT hypothetical protein GT:DATABASE GIB00135CH01 GT:ORG save0 GB:ACCESSION GIB00135CH01 GB:LOCATION 635181..635900 GB:FROM 635181 GB:TO 635900 GB:DIRECTION + GB:PRODUCT hypothetical protein GB:NOTE PF00950: ABC 3 transport family GB:PROTEIN_ID BAC68199.1 LENGTH 239 SQ:AASEQ MSPDRRTAVAAGSLFLLTEAAAIAGAVLYRPLLGAADGRLAQGADTRALLGVLCEVVLVAAVAGTGAALFPVLRRHGEGLALGYAFGRLLEAAVIALGIVAVLALVTLRRDAGAAAGADVALAAVHDWTFLLGPNIALGLNTVLLAYLAYRARLVPRFIAVLGLVGGPLICASAVAVMFGAYAQLSVAGSAAALPVFAWELGLAGWLIVRGFGPGSGATSQADGEVADPVCVSVRPTRA GT:EXON 1|1-239:0| TM:NTM 6 TM:REGION 8->30| TM:REGION 48->70| TM:REGION 83->105| TM:REGION 130->151| TM:REGION 156->178| TM:REGION 189->211| SEG 48->69|allgvlcevvlvaavagtgaal| SEG 89->106|lleaavialgivavlalv| SEG 108->125|lrrdagaaagadvalaav| SEG 144->154|llaylayrarl| OP:NHOMO 4 OP:NHOMOORG 4 OP:PATTERN -------------------------------------------------------------------- -------------------------------------------------------------------1----------------------------------------------------------------------------1--------------------------------------1------------------------------------------------1---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 1-6, 238-239| PSIPRED ccccHHHHHHHcHHHHHHHHHHHHHHHHHHHHHccccccccccccHHHHHHHHHHHHHHHHHHcccHHHHHHHHHccccEEHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccccccHHHHHHHHHHHHEEcccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccHHHHHHHHHHHHHHHHHHEEcccHHHHHHHHHHHHHHEEEEEEEccccccccccccccccccEEEEEccccc //