Streptomyces avermitilis MA-4680 (save0)
Gene : BAC68200.1
DDBJ      :             hypothetical protein

Homologs  Archaea  0/68 : Bacteria  1/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
:100 amino acids
:HMM:PFM   12->60 PF05587 * Anth_Ig 0.0005 16.3 49/105  

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID BAC68200.1 GT:GENE BAC68200.1 GT:PRODUCT hypothetical protein GT:DATABASE GIB00135CH01 GT:ORG save0 GB:ACCESSION GIB00135CH01 GB:LOCATION complement(636261..636563) GB:FROM 636261 GB:TO 636563 GB:DIRECTION - GB:PRODUCT hypothetical protein GB:PROTEIN_ID BAC68200.1 LENGTH 100 SQ:AASEQ MTLTSQVHRSVASGVRSFRRVQPSICLIIRNGCSRSNLRRNACQRRSMPCPDPVADDHSQTGSGSCPPGRKSASRHFNVPLMRGSSPVWSVHVERVVRRG GT:EXON 1|1-100:0| HM:PFM:NREP 1 HM:PFM:REP 12->60|PF05587|0.0005|16.3|49/105|Anth_Ig| OP:NHOMO 1 OP:NHOMOORG 1 OP:PATTERN -------------------------------------------------------------------- -------------------------------------------------------------------1------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 1-7, 56-73| PSIPRED cccHHHHHHHHHHHHHHHHHccccEEEEEcccccccHHHHHHHHHccccccccccccccccccccccccccccccccccEEEcccccHHHHHHHHHHHcc //