[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Streptomyces avermitilis MA-4680 (save0)
Gene : BAC68201.1
DDBJ      :             putative transcriptional regulator
Swiss-Prot:             

Homologs  Archaea  22/68 : Bacteria  407/915 : Eukaryota  4/199 : Viruses  0/175   --->[See Alignment]
a.4.5
:128 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   16->109 1yyvB PDBj 8e-15 42.7 %
:RPS:PDB   18->101 2b0lA PDBj 4e-09 15.7 %
:RPS:SCOP  15->117 1yyvA1  a.4.5.69 * 1e-25 35.9 %
:HMM:SCOP  14->127 2f2eA1 a.4.5.69 * 8.7e-27 36.6 %
:RPS:PFM   29->113 PF01638 * HxlR 4e-17 47.1 %
:HMM:PFM   30->115 PF01638 * HxlR 7.2e-29 45.3 86/91  
:BLT:SWISS 16->109 YTFH_SHIFL 9e-19 40.4 %

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID BAC68201.1 GT:GENE BAC68201.1 GT:PRODUCT putative transcriptional regulator GT:DATABASE GIB00135CH01 GT:ORG save0 GB:ACCESSION GIB00135CH01 GB:LOCATION complement(636931..637317) GB:FROM 636931 GB:TO 637317 GB:DIRECTION - GB:PRODUCT putative transcriptional regulator GB:NOTE PF01638: Transcriptional regulator GB:PROTEIN_ID BAC68201.1 LENGTH 128 SQ:AASEQ MKDTDLHAVGAETPTVFRADCPSRPILDQIADKWSMMVMALLERPTRFNELKRGLEGVTQRVLTQTLRRLERNGMIRRKVLPTSPVGVEYSLTPLGESLREPFGHLYDWTVEHSKEIQNCQRAYDSRG GT:EXON 1|1-128:0| BL:SWS:NREP 1 BL:SWS:REP 16->109|YTFH_SHIFL|9e-19|40.4|94/126| BL:PDB:NREP 1 BL:PDB:REP 16->109|1yyvB|8e-15|42.7|89/107| RP:PDB:NREP 1 RP:PDB:REP 18->101|2b0lA|4e-09|15.7|83/98| RP:PFM:NREP 1 RP:PFM:REP 29->113|PF01638|4e-17|47.1|85/91|HxlR| HM:PFM:NREP 1 HM:PFM:REP 30->115|PF01638|7.2e-29|45.3|86/91|HxlR| RP:SCP:NREP 1 RP:SCP:REP 15->117|1yyvA1|1e-25|35.9|103/114|a.4.5.69| HM:SCP:REP 14->127|2f2eA1|8.7e-27|36.6|112/0|a.4.5.69|1/1|"Winged helix" DNA-binding domain| OP:NHOMO 946 OP:NHOMOORG 433 OP:PATTERN 11----1------11---------2112-111--1----1---551-1--221--------1------ 2---9--2222---1--11-1----31-111--1115132-A4B25-1-11-311--2--211-7-4886--111-11---31-1-1-1211-12----1-5---Q47-1----------------------------------1-3-1322---111-----11-1122----------------11--11-5888888483497568454466717--15-42------8D---------------1----2----------1-11--322-1-222--------12------------1--1---1111--11---11111--4B111111111--2111---11--------231------1---2-112-1133------43444--13212-----------3-2314232715--966464145623424----3-----1211111111-214---1-----------------------------2-21-2-----334261-22221131222222323--1-----31-1--11-11--1--1111------------1--11-1111-31111-11---111-1---11--3-11-1-1--1----------1---22---2--1----------1-------------------------1135-2-1111111111-111111111111111111111154--11111--1---11111121111111--211111111111---------1111--421----11-----1--133434-2----1----1113------122-------------------1----21131321111111---1---------------------1-------------------------------12 --------------------------------------------------------------------------------------------------------------------------------------------------------------1----1------------------------1-----1---- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 119 STR:RPRED 93.0 SQ:SECSTR ####cHHHHHHcccccGHHHHHHHTccHHHHHHHHHHTTcccEEEEcHHHHHHHHTTccHHHHHHHHHHHHHTTcEEEEEcccccEEEEEccHHHHHHHHHHHHHHHHHHHHHEEccccccHH##### DISOP:02AL 1-4, 6-7, 122-128| PSIPRED ccccccccccccccccccccccHHHHHHHHHcHHHHHHHHHHcccccHHHHHHHHccccHHHHHHHHHHHHHcccEEEEEccccccEEEEEHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccc //