[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Streptomyces avermitilis MA-4680 (save0)
Gene : BAC68203.1
DDBJ      :             hypothetical protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  1/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
:111 amino acids
:PSIPRED
:DISOPRED
:HMM:PFM   2->97 PF07690 * MFS_1 5.6e-05 18.3 82/353  
:TM
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID BAC68203.1 GT:GENE BAC68203.1 GT:PRODUCT hypothetical protein GT:DATABASE GIB00135CH01 GT:ORG save0 GB:ACCESSION GIB00135CH01 GB:LOCATION complement(639053..639388) GB:FROM 639053 GB:TO 639388 GB:DIRECTION - GB:PRODUCT hypothetical protein GB:NOTE PF00137: ATP synthase subunit C GB:PROTEIN_ID BAC68203.1 LENGTH 111 SQ:AASEQ MHDYSAALSAGTLAVIARVSLAIGKPFTLGIVKRTTPREAWGLKPFIQTNVIITAVWTAAFTLTAVVLAFMAHAGNAHSTLAMLIQVVGFAVPMIFTVRYVSRVQAKAGAR GT:EXON 1|1-111:0| TM:NTM 3 TM:REGION 9->31| TM:REGION 49->71| TM:REGION 80->102| SEG 54->70|tavwtaaftltavvlaf| HM:PFM:NREP 1 HM:PFM:REP 2->97|PF07690|5.6e-05|18.3|82/353|MFS_1| OP:NHOMO 1 OP:NHOMOORG 1 OP:PATTERN -------------------------------------------------------------------- -------------------------------------------------------------------1------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 1-4, 109-111| PSIPRED cccHHHHHHHHHHHHHHHHHHHHccccEEEEEccccccHHcccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccc //