[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Streptomyces avermitilis MA-4680 (save0)
Gene : BAC68205.1
DDBJ      :             hypothetical protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  1/915 : Eukaryota  0/199 : Viruses  1/175   --->[See Alignment]
:62 amino acids
:PSIPRED
:DISOPRED

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID BAC68205.1 GT:GENE BAC68205.1 GT:PRODUCT hypothetical protein GT:DATABASE GIB00135CH01 GT:ORG save0 GB:ACCESSION GIB00135CH01 GB:LOCATION 641145..641333 GB:FROM 641145 GB:TO 641333 GB:DIRECTION + GB:PRODUCT hypothetical protein GB:PROTEIN_ID BAC68205.1 LENGTH 62 SQ:AASEQ MARGGSITAEYGLEVLNTVIYLPRGEIFPITSSATLCNGFSRHRDGSLQPPSHVGAGAVWRS GT:EXON 1|1-62:0| OP:NHOMO 2 OP:NHOMOORG 2 OP:PATTERN -------------------------------------------------------------------- -------------------------------------------------------------------1------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- -------------------------------------------------------------------------------------------------------------------------------------------------------------1----------------- DISOP:02AL 1-6| PSIPRED ccccccccHHHHHHHHHHHHcccccccccccccHHHHHHHHHcccccccccccccccccccc //