[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Streptomyces avermitilis MA-4680 (save0)
Gene : BAC68206.1
DDBJ      :             hypothetical protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  39/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
d.13.1
:159 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   26->100 2gaiA PDBj 1e-05 33.3 %
:RPS:SCOP  21->153 2oikA1  d.13.1.1 * 3e-09 28.2 %
:HMM:SCOP  7->158 1fitA_ d.13.1.1 * 9.8e-12 20.9 %
:HMM:PFM   43->110 PF01230 * HIT 0.00068 22.1 68/98  
:BLT:SWISS 26->100 TOP1_THEMA 4e-05 33.3 %

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID BAC68206.1 GT:GENE BAC68206.1 GT:PRODUCT hypothetical protein GT:DATABASE GIB00135CH01 GT:ORG save0 GB:ACCESSION GIB00135CH01 GB:LOCATION 641343..641822 GB:FROM 641343 GB:TO 641822 GB:DIRECTION + GB:PRODUCT hypothetical protein GB:NOTE PF01230: HIT domain GB:PROTEIN_ID BAC68206.1 LENGTH 159 SQ:AASEQ MTGDWRMDRIGAALRGENPTVLRRLESGFAVIGDVQFLPGYSVLLVDEPGVQRLSDLPKARRLSFLSDMDRLGEAVEHVCQRLDPDFRRVNLEILGNTDPFLHAHVWPRFEWEPTELVGKPVWLYPGDRWSDEGFRLGPQHDVLRDGIESELDRLRSMG GT:EXON 1|1-159:0| BL:SWS:NREP 1 BL:SWS:REP 26->100|TOP1_THEMA|4e-05|33.3|75/100| BL:PDB:NREP 1 BL:PDB:REP 26->100|2gaiA|1e-05|33.3|75/581| HM:PFM:NREP 1 HM:PFM:REP 43->110|PF01230|0.00068|22.1|68/98|HIT| RP:SCP:NREP 1 RP:SCP:REP 21->153|2oikA1|3e-09|28.2|124/139|d.13.1.1| HM:SCP:REP 7->158|1fitA_|9.8e-12|20.9|139/146|d.13.1.1|1/1|HIT-like| OP:NHOMO 40 OP:NHOMOORG 39 OP:PATTERN -------------------------------------------------------------------- ------------------------------------------1-------1---------1------1----------1----------------------------------------------------------------------------------------------------------------------------------1--------------------------------------------1--11----1----11----1-----11-----1111111211111-----------------------------------------------------------------------------------------------------------------------------------------------------11111111---1---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1-------------------------------------------------------------------1---------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 87 STR:RPRED 54.7 SQ:SECSTR #########################cccccEETTTTcEEccEEcTTcHHHHHHHHHHHHHccEEEcccccHHHHHHHHHHHHHHTcTTcccccccccccHcccEEETTcccT############################################### DISOP:02AL 158-159| PSIPRED cccccHHHHHHHHHcccccEEEEEccEEEEEEEcccccccEEEEEEccccccccccccHHHHHHHHHHHHHHHHHHHHHHHHcccccccccHHHHcccccEEEEEEEEEccccccccccccEEcccccccccHHHHHHHHHHHHHHHHHHHHHHHHccc //