[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Streptomyces avermitilis MA-4680 (save0)
Gene : BAC68209.1
DDBJ      :             hypothetical protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  3/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
:215 amino acids
:PSIPRED
:DISOPRED
:HMM:PFM   149->176 PF08273 * Prim_Zn_Ribbon 3.2e-06 42.9 28/40  
:HMM:PFM   98->117 PF10013 * DUF2256 0.0005 40.0 20/42  

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID BAC68209.1 GT:GENE BAC68209.1 GT:PRODUCT hypothetical protein GT:DATABASE GIB00135CH01 GT:ORG save0 GB:ACCESSION GIB00135CH01 GB:LOCATION complement(643080..643727) GB:FROM 643080 GB:TO 643727 GB:DIRECTION - GB:PRODUCT hypothetical protein GB:NOTE PF00320: GATA zinc finger GB:PROTEIN_ID BAC68209.1 LENGTH 215 SQ:AASEQ MSSFNTHQRRVYDEDLPTRARHTNLRSCLVHFAPYGFRATYHHLCLSAGIPKDLEKDPSSLIRAVEELHHARQLWLADERAYANRRRADKARGFRQVKRDESWRGWQREWGNIAYCPEPTIHPDEPLPAVVERVLRSSVPPDEAPALTCRVCGNRDNTSVWYDGAYRIHQLCRECGVSLAVQRAKAPDPRLAADHARKWKEIWRLRNESPRSYPS GT:EXON 1|1-215:0| HM:PFM:NREP 2 HM:PFM:REP 149->176|PF08273|3.2e-06|42.9|28/40|Prim_Zn_Ribbon| HM:PFM:REP 98->117|PF10013|0.0005|40.0|20/42|DUF2256| OP:NHOMO 4 OP:NHOMOORG 3 OP:PATTERN -------------------------------------------------------------------- -------------------------------------------------------------------211----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 1-7, 85-94, 208-215| PSIPRED ccHHHHHHHHHccccccHHHHHHHHHHHHHHHccccccHHHHHHHHHccccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccccccHHHHHHHccccEEEcccccccccHHHHHHHHHHHHHHccccccccccccccccccccHHccccccccccHHHHcccEEEEcccccccHHHHHHHHHHHHHHHHHHccccccccc //