[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Streptomyces avermitilis MA-4680 (save0)
Gene : BAC68210.1
DDBJ      :             hypothetical protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  1/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
:87 amino acids
:PSIPRED
:DISOPRED
:HMM:PFM   23->66 PF09352 * DUF1994 4.4e-06 32.6 43/162  

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID BAC68210.1 GT:GENE BAC68210.1 GT:PRODUCT hypothetical protein GT:DATABASE GIB00135CH01 GT:ORG save0 GB:ACCESSION GIB00135CH01 GB:LOCATION 643739..644002 GB:FROM 643739 GB:TO 644002 GB:DIRECTION + GB:PRODUCT hypothetical protein GB:PROTEIN_ID BAC68210.1 LENGTH 87 SQ:AASEQ MPYHTRIALHFDSRFRLGRVLNESAARTKSEYRHHLHLAAPYAGYWCQYVTDWVADKTRYRLTIDPTALAQRLAECPDLPITITLAR GT:EXON 1|1-87:0| HM:PFM:NREP 1 HM:PFM:REP 23->66|PF09352|4.4e-06|32.6|43/162|DUF1994| OP:NHOMO 1 OP:NHOMOORG 1 OP:PATTERN -------------------------------------------------------------------- -------------------------------------------------------------------1------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 1-2| PSIPRED ccccEEEEEEEccccHHHHHHHHHHHHHHHHHHHEEEEEccccHHHHHHHHHHHcccEEEEEEEcHHHHHHHHHHcccccEEEEEEc //