Streptomyces avermitilis MA-4680 (save0)
Gene : BAC68213.1
DDBJ      :             hypothetical protein

Homologs  Archaea  0/68 : Bacteria  1/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
:82 amino acids

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID BAC68213.1 GT:GENE BAC68213.1 GT:PRODUCT hypothetical protein GT:DATABASE GIB00135CH01 GT:ORG save0 GB:ACCESSION GIB00135CH01 GB:LOCATION complement(646464..646712) GB:FROM 646464 GB:TO 646712 GB:DIRECTION - GB:PRODUCT hypothetical protein GB:PROTEIN_ID BAC68213.1 LENGTH 82 SQ:AASEQ MPAGTAGPAPAAGRELLGPGRQQRRDQRPPASEAHLNWSLITLMSRRLTRKGHPDGWKKTGPMRKPGPTTLNQPRTSREMDG GT:EXON 1|1-82:0| SEG 2->13|pagtagpapaag| SEG 18->30|gpgrqqrrdqrpp| OP:NHOMO 1 OP:NHOMOORG 1 OP:PATTERN -------------------------------------------------------------------- -------------------------------------------------------------------1------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 1-8, 16-33, 50-82| PSIPRED cccccccccccccHHHccccHHHHHHcccccccHHHHHHHHHHHHHHHHHcccccccccccccccccccccccccccccccc //