[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Streptomyces avermitilis MA-4680 (save0)
Gene : BAC68224.1
DDBJ      :             hypothetical protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  2/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
:158 amino acids
:PSIPRED
:DISOPRED
:HMM:PFM   72->114 PF10263 * SprT-like 0.00045 20.9 43/159  
:BLT:SWISS 90->156 T701_FREDI 9e-05 42.6 %

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID BAC68224.1 GT:GENE BAC68224.1 GT:PRODUCT hypothetical protein GT:DATABASE GIB00135CH01 GT:ORG save0 GB:ACCESSION GIB00135CH01 GB:LOCATION 658738..659214 GB:FROM 658738 GB:TO 659214 GB:DIRECTION + GB:PRODUCT hypothetical protein GB:PROTEIN_ID BAC68224.1 LENGTH 158 SQ:AASEQ MTPSASHPRPIAAPSSTRLPDGEGQTGRHGTWAYGSDAHTPVDAARLLAWPRLASQDAERPGDWARIERTCRDGHTATWRAAEARLGRWGPDGNVRLAVATAHPATLPAKATWYPATDLPRPGSPRVTESPCPPTTLAEIERIYGLRHWVEQSYKQVV GT:EXON 1|1-158:0| BL:SWS:NREP 1 BL:SWS:REP 90->156|T701_FREDI|9e-05|42.6|54/380| HM:PFM:NREP 1 HM:PFM:REP 72->114|PF10263|0.00045|20.9|43/159|SprT-like| OP:NHOMO 2 OP:NHOMOORG 2 OP:PATTERN -------------------------------------------------------------------- -------------------------------------------1-----------------------1------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 1-24| PSIPRED ccccccccccccccccccccccccccccccccccccccccHHHHHHHHHHHHHHHHcccccccHHHHHHHHcccccccHHHHHHHcccccccccEEEEEEEccccccccccEEcccccccccccccccccccccHHHHHHHHHHHHHHHHHHHHHHcc //