[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Streptomyces avermitilis MA-4680 (save0)
Gene : BAC68225.1
DDBJ      :             putative oxidoreductase with iron-sulfur subunit
Swiss-Prot:             

Homologs  Archaea  22/68 : Bacteria  385/915 : Eukaryota  130/199 : Viruses  0/175   --->[See Alignment]
a.56.1d.15.4
:158 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   3->150 1dgjA PDBj 9e-26 40.8 %
:RPS:PDB   7->150 3b9jA PDBj 1e-45 36.8 %
:RPS:SCOP  3->81 1dgjA2  d.15.4.2 * 1e-23 35.4 %
:RPS:SCOP  85->152 1ffuA1  a.56.1.1 * 4e-25 39.7 %
:HMM:SCOP  3->81 1n62A2 d.15.4.2 * 9e-25 43.0 %
:HMM:SCOP  76->154 1dgjA1 a.56.1.1 * 3.2e-30 45.2 %
:RPS:PFM   9->59 PF00111 * Fer2 3e-07 51.0 %
:RPS:PFM   76->147 PF01799 * Fer2_2 1e-15 51.4 %
:HMM:PFM   76->147 PF01799 * Fer2_2 2.1e-30 48.6 72/75  
:HMM:PFM   10->59 PF00111 * Fer2 3.7e-09 28.6 49/77  
:BLT:SWISS 8->150 IORA_BREDI 4e-41 54.9 %

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID BAC68225.1 GT:GENE BAC68225.1 GT:PRODUCT putative oxidoreductase with iron-sulfur subunit GT:DATABASE GIB00135CH01 GT:ORG save0 GB:ACCESSION GIB00135CH01 GB:LOCATION complement(659554..660030) GB:FROM 659554 GB:TO 660030 GB:DIRECTION - GB:PRODUCT putative oxidoreductase with iron-sulfur subunit GB:NOTE PF01799: [2Fe-2S] binding domain GB:PROTEIN_ID BAC68225.1 LENGTH 158 SQ:AASEQ MPMPSYSFVLNGERVTVEAPADMPLLWVLRDLLNVTGPKYGCGVGVCRACTSHLDGGEIQPCVVPVADCADREVTTIEGLADGNRLHPVQQAWLDCDVAQCGFCQPGQIMAAVALLKRTPRPSDADIDAIENVCRCGTYFRIREAIKKASVKFPRSGP GT:EXON 1|1-158:0| BL:SWS:NREP 1 BL:SWS:REP 8->150|IORA_BREDI|4e-41|54.9|142/152| BL:PDB:NREP 1 BL:PDB:REP 3->150|1dgjA|9e-26|40.8|147/906| RP:PDB:NREP 1 RP:PDB:REP 7->150|3b9jA|1e-45|36.8|144/162| RP:PFM:NREP 2 RP:PFM:REP 9->59|PF00111|3e-07|51.0|49/71|Fer2| RP:PFM:REP 76->147|PF01799|1e-15|51.4|72/75|Fer2_2| HM:PFM:NREP 2 HM:PFM:REP 76->147|PF01799|2.1e-30|48.6|72/75|Fer2_2| HM:PFM:REP 10->59|PF00111|3.7e-09|28.6|49/77|Fer2| GO:PFM:NREP 5 GO:PFM GO:0009055|"GO:electron carrier activity"|PF00111|IPR001041| GO:PFM GO:0051536|"GO:iron-sulfur cluster binding"|PF00111|IPR001041| GO:PFM GO:0016491|"GO:oxidoreductase activity"|PF01799|IPR002888| GO:PFM GO:0046872|"GO:metal ion binding"|PF01799|IPR002888| GO:PFM GO:0055114|"GO:oxidation reduction"|PF01799|IPR002888| RP:SCP:NREP 2 RP:SCP:REP 3->81|1dgjA2|1e-23|35.4|79/80|d.15.4.2| RP:SCP:REP 85->152|1ffuA1|4e-25|39.7|68/76|a.56.1.1| HM:SCP:REP 3->81|1n62A2|9e-25|43.0|79/79|d.15.4.2|1/1|2Fe-2S ferredoxin-like| HM:SCP:REP 76->154|1dgjA1|3.2e-30|45.2|73/113|a.56.1.1|1/1|CO dehydrogenase ISP C-domain like| OP:NHOMO 1596 OP:NHOMOORG 537 OP:PATTERN 113-1-2322223323--21111-2---1--------------------------------1------ 13913---------1--11-12--5711111333331369221211---11-212-----1-9-3494541-------1---3---1--------------1-245-5----------------------------22211----5-1-111---------------1-2--------------12-------1-----1---------12---1----21-----------1--------------------1----------------------------------------------------------------------53-24444344434-3------31-21-112-311332-213-------4--4232-----24FGH41337495111111111-1-A9E88CAD562-52241184318C7523-66144445564444444463331521------------------------------2341-45445ABBBBA22221BBCC22221285GCAD4-266543311814191131-1111-----------221--3-4111121111--1113111311-133-4-------------------------111--4112-4-112222231111111--1-1----1---------1--1--2221211-21-2222111212211221221------------------------51--1111-----------------------------321---------------1111111-114166663284464553433---------1---2----------1122222----------2--------------1----------------------------2221-----13- ----11------11-21-11121111111131211111111111211-11111111-11111-----------1------------------1-------1------262B23223822122426D251352-324121242251-2-21B-192623213E257256AC7B335-11-7-----21241121-1-112 ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 153 STR:RPRED 96.8 SQ:SECSTR HHEEEEEEEETTEEEEETccTTccHHHHHHHTccccccccccccccccTTEEEEEEEcTTTTTccGGGcTTcEEEcGGGTcTTccccHHHHHHHHTTcccccTTHHHHHHHHHHHHHHcccccHHHHHHTTccccccccHHHHHHHGGGcHcc##### DISOP:02AL 154-158| PSIPRED ccccEEEEEEccEEEEEEEcccccHHHHHHHHcccccccccccccccccEEEEEccEEHHHHHHHHHHHcccEEEEEEcccccccccHHHHHHHHHcccccccccHHHHHHHHHHHHccccccHHHHHHHcccccccccHHHHHHHHHHHHHHHHccc //