[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Streptomyces avermitilis MA-4680 (save0)
Gene : BAC68232.1
DDBJ      :             hypothetical protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  27/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
:69 amino acids
:PSIPRED
:DISOPRED
:HMM:PFM   13->65 PF11800 * RP-C_C 3.8e-05 24.5 53/208  

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID BAC68232.1 GT:GENE BAC68232.1 GT:PRODUCT hypothetical protein GT:DATABASE GIB00135CH01 GT:ORG save0 GB:ACCESSION GIB00135CH01 GB:LOCATION 665728..665937 GB:FROM 665728 GB:TO 665937 GB:DIRECTION + GB:PRODUCT hypothetical protein GB:PROTEIN_ID BAC68232.1 LENGTH 69 SQ:AASEQ MTTPAKGPVSYFPAIEKKYGRPIAEWKDIIRTSPLTKHMELVAWLKAEHGLGHGHANALVAHTLAEGSR GT:EXON 1|1-69:0| HM:PFM:NREP 1 HM:PFM:REP 13->65|PF11800|3.8e-05|24.5|53/208|RP-C_C| OP:NHOMO 27 OP:NHOMOORG 27 OP:PATTERN -------------------------------------------------------------------- -------------------------------------111----1----1-----------------111--------------------------------------------------------------------------1------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1----------------------------------1-11-11-1---------------11---1---------------------------------------------------------------------------------------------------------1-------------------------------------------------------------------------------------------1------11--1---------------------------------------------------------------------------------------------------------------------------------------------------------------1-----------------------------------11----------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 1-6, 67-69| PSIPRED ccccccccHHHcccHHHHHcccHHHHHHHHHccccHHHHHHHHHHHHHccccccHHHHHHHHHHHcccc //