[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Streptomyces avermitilis MA-4680 (save0)
Gene : BAC68236.1
DDBJ      :             hypothetical protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  1/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
:141 amino acids
:PSIPRED
:DISOPRED
:HMM:PFM   6->134 PF12158 * DUF3592 1.1e-14 23.8 126/148  
:TM
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID BAC68236.1 GT:GENE BAC68236.1 GT:PRODUCT hypothetical protein GT:DATABASE GIB00135CH01 GT:ORG save0 GB:ACCESSION GIB00135CH01 GB:LOCATION complement(670688..671113) GB:FROM 670688 GB:TO 671113 GB:DIRECTION - GB:PRODUCT hypothetical protein GB:PROTEIN_ID BAC68236.1 LENGTH 141 SQ:AASEQ MQREWLFSLIPLTIGVVFLSFGVYGLRRAKALRRTGVTAPGRIVRHDVRRDDDGARYHHPVAAWTTPDGLECEHSSRFGRGSIGGRFGVGALVVVRYDPENPRRFEIQGWDSAIVDRTFTILGALLTAATLTVLLVRLLTL GT:EXON 1|1-141:0| TM:NTM 2 TM:REGION 5->26| TM:REGION 117->139| SEG 42->53|rivrhdvrrddd| SEG 75->90|ssrfgrgsiggrfgvg| SEG 118->140|tftilgalltaatltvllvrllt| HM:PFM:NREP 1 HM:PFM:REP 6->134|PF12158|1.1e-14|23.8|126/148|DUF3592| OP:NHOMO 1 OP:NHOMOORG 1 OP:PATTERN -------------------------------------------------------------------- -------------------------------------------------------------------1------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 1-2| PSIPRED ccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccccHHHHHHHccccccccccccEEEcccccccccccccccccccccccccccEEEEEEEccccccEEEEccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHcc //