[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Streptomyces avermitilis MA-4680 (save0)
Gene : BAC68238.1
DDBJ      :             putative ABC transporter permease protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  2/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
:272 amino acids
:PSIPRED
:DISOPRED
:TM
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID BAC68238.1 GT:GENE BAC68238.1 GT:PRODUCT putative ABC transporter permease protein GT:DATABASE GIB00135CH01 GT:ORG save0 GB:ACCESSION GIB00135CH01 GB:LOCATION 672570..673388 GB:FROM 672570 GB:TO 673388 GB:DIRECTION + GB:PRODUCT putative ABC transporter permease protein GB:NOTE PF01061: ABC-2 type transporter GB:PROTEIN_ID BAC68238.1 LENGTH 272 SQ:AASEQ MSVEHASMRIIDGYARGDTDIAADEVWALEAHLEACGVCRDRLSAAVTAEAPAVAALVGTVWSGLEPQLAATATMPRQRRWSARLSRWMTPTMMPWLAMVVSVTLLALLLDLVDTGFGEVSLVLLLAPILPVLGVAASWSRGLDPAYELTASAPRAGLYLVLRRTASVLAVVVPVLLVAGWVTGVTAAQWLLPCLAFTSTTLALGGVVGVTRAAVSLAAVWAAAVVAPTLATSRTTFALQTGSLPVWGLVLALGTAVVIARRGAYSVLGAHR GT:EXON 1|1-272:0| TM:NTM 6 TM:REGION 44->66| TM:REGION 91->113| TM:REGION 119->141| TM:REGION 166->188| TM:REGION 201->223| TM:REGION 242->260| SEG 45->58|aavtaeapavaalv| SEG 97->115|lamvvsvtllallldlvdt| SEG 122->137|lvlllapilpvlgvaa| SEG 166->179|asvlavvvpvllva| SEG 213->233|aavslaavwaaavvaptlats| OP:NHOMO 2 OP:NHOMOORG 2 OP:PATTERN -------------------------------------------------------------------- ----------------------------------------------------------------1--1------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 1-6| PSIPRED ccccHHHHHEEEccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccHHHHHHHHHHHccccccHHHHHcccHHHHHHHHHHHcccHHHHHHHHHHHHHHHHHHHHHHHHccccHHHHHHHHHHHHHHHHHHHHHHccccHHHHHHcccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccEEEEEEccccHHHHHHHHHHHHHHHHHcccHHHHcccc //