[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Streptomyces avermitilis MA-4680 (save0)
Gene : BAC68239.1
DDBJ      :             putative ABC transporter ATP-binding protein
Swiss-Prot:             

Homologs  Archaea  68/68 : Bacteria  906/915 : Eukaryota  195/199 : Viruses  0/175   --->[See Alignment]
c.37.1
:277 amino acids
:PSIPRED
:DISOPRED
:BLT:PDB   32->245 1vplA PDBj 8e-28 30.7 %
:RPS:PDB   27->245 3dmdC PDBj 7e-33 13.0 %
:RPS:SCOP  27->245 1b0uA  c.37.1.12 * 4e-31 26.3 %
:HMM:SCOP  31->244 1ii8.1 c.37.1.12 * 2.6e-61 39.2 %
:RPS:PFM   66->188 PF00005 * ABC_tran 3e-16 40.7 %
:HMM:PFM   66->188 PF00005 * ABC_tran 9.6e-26 37.7 114/118  
:HMM:PFM   36->75 PF03193 * DUF258 0.00027 25.6 39/161  
:BLT:SWISS 42->252 PHNC1_RHOP2 6e-31 42.2 %
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID BAC68239.1 GT:GENE BAC68239.1 GT:PRODUCT putative ABC transporter ATP-binding protein GT:DATABASE GIB00135CH01 GT:ORG save0 GB:ACCESSION GIB00135CH01 GB:LOCATION 673385..674218 GB:FROM 673385 GB:TO 674218 GB:DIRECTION + GB:PRODUCT putative ABC transporter ATP-binding protein GB:NOTE PF00005: ABC transporter GB:PROTEIN_ID BAC68239.1 LENGTH 277 SQ:AASEQ MTIGKEHHMMSAVSAAGIAPTAYAWQIQATGLKVRVGRKRMAVNGVDLSLGTGVHGLLGPNGAGKTTLIRTLATVLRPTEGTLEMLGESAGGMGEHRALRRRIGYLPQEFGYYKRFTVREFVEYMAWLKEVPKADIPAAVQRAVERVGLADRADERMKALSGGMVRRVGIAQAIVNDPTILLLDEPTAGLDPAQRLRFRELLQELGTDTCVLVSTHLVEDVAAACTNVVLFAEGRLVFQGPPDELASVGGPEHMGDSPLERGYSAMLLNPEQGRGTW GT:EXON 1|1-277:0| BL:SWS:NREP 1 BL:SWS:REP 42->252|PHNC1_RHOP2|6e-31|42.2|206/280| SEG 194->205|qrlrfrellqel| BL:PDB:NREP 1 BL:PDB:REP 32->245|1vplA|8e-28|30.7|212/238| RP:PDB:NREP 1 RP:PDB:REP 27->245|3dmdC|7e-33|13.0|200/318| RP:PFM:NREP 1 RP:PFM:REP 66->188|PF00005|3e-16|40.7|118/123|ABC_tran| HM:PFM:NREP 2 HM:PFM:REP 66->188|PF00005|9.6e-26|37.7|114/118|ABC_tran| HM:PFM:REP 36->75|PF03193|0.00027|25.6|39/161|DUF258| GO:PFM:NREP 2 GO:PFM GO:0005524|"GO:ATP binding"|PF00005|IPR003439| GO:PFM GO:0016887|"GO:ATPase activity"|PF00005|IPR003439| RP:SCP:NREP 1 RP:SCP:REP 27->245|1b0uA|4e-31|26.3|217/258|c.37.1.12| HM:SCP:REP 31->244|1ii8.1|2.6e-61|39.2|212/370|c.37.1.12|1/1|P-loop containing nucleoside triphosphate hydrolases| OP:NHOMO 39380 OP:NHOMOORG 1169 OP:PATTERN UUKAMKFLNNOLMKMOfFKOJNNUpMQcfZfXE8DBBAFDGDAUbNZgMO*sc8NeMQVNNEEDQ166 QUuN*WZbffiVYTTPRJJ-Je88U*JJJJJKnmlow***T*b*l*rhodaItriJOZCCmn*e*pw***dURQQqXUQLuWfB7A7BLLLH3JDFA--DELEHHaGVPK42222226665555AQOCMRGHRNSMdjkqvGGGoZkYfoYXcZcRRIIHGKEacWhtwqLDGCDBACHACB9ZVZNMZP6Pdo********r********ssmt***Ylj*uYjmoolji**RTTURURRRRTTTRQPSMPPgURSpqSMTNVonJKttVPKQbTXXXbZcgbZfkkjjjgiihikhihTTSSRTTSVUTSRnceVUWgfhda*kw********e*ahsssVXaV*iebV*ahOK**caXYXTOYYQZaILNZKbVTTKHJGGHZQ***UTn*****xzvyzs*vvw*-hm*eX*i***PB**************HJNz*******y*POPPPPPPkWZJQiay445-4333234544775445444445565FEEDDCt**x*******ttsup*****x*zg****w**v7Gtrnvbljo*x****TijIOJIfMGGIIHHHMMMXjdXq*MVOhbUfiZYiHcXXQRUcQTYaYZnuUxAEHMAFDDHDA697777877CMDEFMLfdiJmRTFRHhOQRSQMPWQOOPOSURRSV6-AJNPN11-111xh**Pxilmmlmnkmii-lkljpjnkljmnjghkhgf*****XYSadYabababaababaZ*daZggdiM4uz*****yx***34GDDECDEJIIKMGxg*PORSTOCGIFEKGHUJLLKLCNAFOiYsqqro***sxymte***888687888EUZXmZZaaZjmhiePQNLMLLIKKGFEF34JNIICDDE65455556kCM76749-4464897333359654334LdVIHPhRWPDbK 1-12TUH-VH6CHRKEBF7DDHDL9KHEE9B9ADEC7CABA99B999AFHDDMEGFH78CDC556444154455612-2217667B11-9D7BA99666662ANKF2PeaWLPOYTUGDC9HRHhiAmD**d4fMgIHF9XFDWOAFBDBTD9*GRNJhFW*HbKdBuWY*KTQBEJGE*DEBHNuei*A*lDD*r**c ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 1-23, 271-277| PSIPRED cccccccccccccccccccccccccEEEEEEEEEEEcccEEEEEcccEEEcccEEEEEccccccHHHHHHHHHHcccccccEEEEEcccccccccHHHHHHHcccccccccccccccHHHHHHHHHHHccccHHHHHHHHHHHHHHcccHHHHcccHHHcccHHHHHHHHHHHHHccccEEEEEcccccccHHHHHHHHHHHHHHHcccEEEEEEccHHHHHHHHcEEEEEEccEEEEEccHHHHHHHHccccEEcccHHHHHHHHHcccHHHcccc //