[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Streptomyces avermitilis MA-4680 (save0)
Gene : BAC68241.1
DDBJ      :             hypothetical protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  2/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
:191 amino acids
:PSIPRED
:DISOPRED
:TM
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID BAC68241.1 GT:GENE BAC68241.1 GT:PRODUCT hypothetical protein GT:DATABASE GIB00135CH01 GT:ORG save0 GB:ACCESSION GIB00135CH01 GB:LOCATION 675606..676181 GB:FROM 675606 GB:TO 676181 GB:DIRECTION + GB:PRODUCT hypothetical protein GB:NOTE PF00960: Neocarzinostatin family GB:PROTEIN_ID BAC68241.1 LENGTH 191 SQ:AASEQ MRWLTLYARSRQIPASLAAVVISAVAVWALARNGSGGPGDPRLPALALATGTMAASIGLSGQDLALDRTAAIRWVPRRAAHVLLCGAVVGTALLTAQAMGEDMATTAFVVRDSAGLMGLVALGAALSGGRHAWTLPFAWLSFSFFAPPPTSVPMRVASWMLLPPGTAAGTWTALVLAVVGTAAYAVAGPRR GT:EXON 1|1-191:0| TM:NTM 5 TM:REGION 13->35| TM:REGION 43->65| TM:REGION 79->101| TM:REGION 105->127| TM:REGION 171->188| SEG 15->31|aslaavvisavavwala| SEG 114->129|aglmglvalgaalsgg| SEG 172->188|talvlavvgtaayavag| OP:NHOMO 2 OP:NHOMOORG 2 OP:PATTERN -------------------------------------------------------------------- ----------------------------------------------------------------1--1------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 35-37, 190-191| PSIPRED ccEEEEEEcccccHHHHHHHHHHHHHHHHHHcccccccccccccccEEEHHHHHHHcccccccEEEcHHHHHEEcHHHHHHHHHHHHHHHHHHHHHHHHcccHHHEEEEEEccccHHHHHHHHHHHccccEEEEEEHHHHEEEEcccccccccHHHHEEEEEccccccHHHHHHHHHHHHHHHHHHccccc //