[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Streptomyces avermitilis MA-4680 (save0)
Gene : BAC68242.1
DDBJ      :             hypothetical protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  4/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
:124 amino acids
:PSIPRED
:DISOPRED
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID BAC68242.1 GT:GENE BAC68242.1 GT:PRODUCT hypothetical protein GT:DATABASE GIB00135CH01 GT:ORG save0 GB:ACCESSION GIB00135CH01 GB:LOCATION 676319..676693 GB:FROM 676319 GB:TO 676693 GB:DIRECTION + GB:PRODUCT hypothetical protein GB:PROTEIN_ID BAC68242.1 LENGTH 124 SQ:AASEQ MVVATPAKGKRLTDAVGAQNIAFSRPAGERVTAFGCPATTPQRGEELLYCPGNSQRAPEGEQRVPCDLGGGASGGPWLAGFNSAAGKGTVVSVNSDGEGDGGTPMYGPTLDKTARAVYDAAQRG GT:EXON 1|1-124:0| SEG 68->80|lgggasggpwlag| OP:NHOMO 4 OP:NHOMOORG 4 OP:PATTERN -------------------------------------------------------------------- -----------------------------------------------------1----------11-1------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 5-7, 122-124| PSIPRED cEEccccccccHHHHHccccEEEccccccEEEEEEccccccccccccEEEcccccccccccEEcccccccccccccEEEEEccccccEEEEEEEcccccccccEEEcccccHHHHHHHHHHHcc //