[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Streptomyces avermitilis MA-4680 (save0)
Gene : BAC68243.1
DDBJ      :             hypothetical protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  1/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
:78 amino acids
:PSIPRED
:DISOPRED
:HMM:PFM   26->39 PF12581 * DUF3756 0.0005 35.7 14/41  
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID BAC68243.1 GT:GENE BAC68243.1 GT:PRODUCT hypothetical protein GT:DATABASE GIB00135CH01 GT:ORG save0 GB:ACCESSION GIB00135CH01 GB:LOCATION 676902..677138 GB:FROM 676902 GB:TO 677138 GB:DIRECTION + GB:PRODUCT hypothetical protein GB:PROTEIN_ID BAC68243.1 LENGTH 78 SQ:AASEQ MAPRSSKSWSTTAAASPARSPQPSPHHRCSVGVHGAEWTWPSLVMILSGHMEATTPLGARAGVGLFEVVMYSLAVRPG GT:EXON 1|1-78:0| SEG 5->25|sskswsttaaasparspqpsp| HM:PFM:NREP 1 HM:PFM:REP 26->39|PF12581|0.0005|35.7|14/41|DUF3756| OP:NHOMO 1 OP:NHOMOORG 1 OP:PATTERN -------------------------------------------------------------------- -------------------------------------------------------------------1------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 1-27| PSIPRED cccccccccccccccccccccccccccEEEEccccccccHHHHHHHHHcccccccccccccccHHHHHHHHHHHcccc //