[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Streptomyces avermitilis MA-4680 (save0)
Gene : BAC68245.1
DDBJ      :             hypothetical protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  12/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
:110 amino acids
:PSIPRED
:DISOPRED

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID BAC68245.1 GT:GENE BAC68245.1 GT:PRODUCT hypothetical protein GT:DATABASE GIB00135CH01 GT:ORG save0 GB:ACCESSION GIB00135CH01 GB:LOCATION 678091..678423 GB:FROM 678091 GB:TO 678423 GB:DIRECTION + GB:PRODUCT hypothetical protein GB:PROTEIN_ID BAC68245.1 LENGTH 110 SQ:AASEQ MDTDGQDHLPCPGAQAARRGSRPPPSVGQDLLDCELVTAPQQGVDVATDLPGLQRFAQRLERDLEAVIAGLAQPWIAGVVEGHVNRVKMLMRHMFGLAGFDLSRDRVLLA GT:EXON 1|1-110:0| OP:NHOMO 22 OP:NHOMOORG 12 OP:PATTERN -------------------------------------------------------------------- ---------------------------------------1-114-----------------------43----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1-------------------------1------------------------------------------------2------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------2-----------1--------------1------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------ ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 1-4, 13-26| PSIPRED cccccccccccccHHHHHcccccccccHHHHHHHHHHHccccccccccccHHHHHHHHHHHHHHHHHHHHHHcccccccccEEEcHHHHHHHHHHccccHHHHHHHHHcc //