[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Streptomyces avermitilis MA-4680 (save0)
Gene : BAC68246.1
DDBJ      :             hypothetical protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  2/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
:96 amino acids
:PSIPRED
:DISOPRED

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID BAC68246.1 GT:GENE BAC68246.1 GT:PRODUCT hypothetical protein GT:DATABASE GIB00135CH01 GT:ORG save0 GB:ACCESSION GIB00135CH01 GB:LOCATION complement(678456..678746) GB:FROM 678456 GB:TO 678746 GB:DIRECTION - GB:PRODUCT hypothetical protein GB:PROTEIN_ID BAC68246.1 LENGTH 96 SQ:AASEQ MINLQVRHESGTVLAGSGHGVAWDESLAEIDRSQFPMLAGVCPFADTVFNTWQLPMLVEELDRLPAARGGPWVDAVRALCRTAEEGSHRYVWFVGD GT:EXON 1|1-96:0| OP:NHOMO 2 OP:NHOMOORG 2 OP:PATTERN -------------------------------------------------------------------- -------------------------------------------1-----------------------1------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 1-7| PSIPRED ccEEEEEcccccEEEccccccccHHHHHHHHHHcccHHHccccHHHHHHcccccHHHHHHHHHccccccccHHHHHHHHHHHHcccccEEEEEEcc //