[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Streptomyces avermitilis MA-4680 (save0)
Gene : BAC68247.1
DDBJ      :             putative Sir2-family regulator protein
Swiss-Prot:             

Homologs  Archaea  35/68 : Bacteria  457/915 : Eukaryota  176/199 : Viruses  0/175   --->[See Alignment]
c.31.1
:303 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   35->285 1s7gE PDBj 4e-24 33.0 %
:RPS:PDB   21->291 3d81A PDBj 2e-19 26.3 %
:RPS:SCOP  23->282 1iciA  c.31.1.5 * 6e-52 31.7 %
:HMM:SCOP  12->289 1j8fA_ c.31.1.5 * 8.3e-75 40.9 %
:RPS:PFM   39->215 PF02146 * SIR2 3e-29 56.3 %
:HMM:PFM   39->240 PF02146 * SIR2 3.5e-45 38.5 174/181  
:BLT:SWISS 1->299 NPD1_STRCO e-128 80.3 %
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID BAC68247.1 GT:GENE BAC68247.1 GT:PRODUCT putative Sir2-family regulator protein GT:DATABASE GIB00135CH01 GT:ORG save0 GB:ACCESSION GIB00135CH01 GB:LOCATION 679055..679966 GB:FROM 679055 GB:TO 679966 GB:DIRECTION + GB:PRODUCT putative Sir2-family regulator protein GB:NOTE PF02146: Sir2 family GB:PROTEIN_ID BAC68247.1 LENGTH 303 SQ:AASEQ MRMRPTLSWTPPEDLPPATTDVEPVARALSNGGVLVLSGAGISTDSGIPDYRGEGGSLSRHTPMTYQDFTAGVQARRRYWARSHLGWRTFGRARPNAGHRAVAAFARHGLLSGVITQNVDGLHQAAGSESVVELHGSLERVVCLSCGAFTPRRELALRLAEANVGFEPVAAGINPDGDADLTDEQVGDFRVVPCTACGGILKPDVVFFGEAVPARRVQHCRTLVDQATSLLVLGSSLTVMSGLRFVRQAAQAGKPVLIINRDATRGDPHAVTRIALPLGTALTTVAGRLDIPADDEAAAQTRQ GT:EXON 1|1-303:0| BL:SWS:NREP 1 BL:SWS:REP 1->299|NPD1_STRCO|e-128|80.3|299/299| SEG 228->243|tsllvlgssltvmsgl| BL:PDB:NREP 1 BL:PDB:REP 35->285|1s7gE|4e-24|33.0|221/248| RP:PDB:NREP 1 RP:PDB:REP 21->291|3d81A|2e-19|26.3|232/235| RP:PFM:NREP 1 RP:PFM:REP 39->215|PF02146|3e-29|56.3|142/178|SIR2| HM:PFM:NREP 1 HM:PFM:REP 39->240|PF02146|3.5e-45|38.5|174/181|SIR2| GO:PFM:NREP 6 GO:PFM GO:0006342|"GO:chromatin silencing"|PF02146|IPR003000| GO:PFM GO:0006476|"GO:protein amino acid deacetylation"|PF02146|IPR003000| GO:PFM GO:0008270|"GO:zinc ion binding"|PF02146|IPR003000| GO:PFM GO:0016811|"GO:hydrolase activity, acting on carbon-nitrogen (but not peptide) bonds, in linear amides"|PF02146|IPR003000| GO:PFM GO:0045449|"GO:regulation of transcription"|PF02146|IPR003000| GO:PFM GO:0070403|"GO:NAD binding"|PF02146|IPR003000| RP:SCP:NREP 1 RP:SCP:REP 23->282|1iciA|6e-52|31.7|230/256|c.31.1.5| HM:SCP:REP 12->289|1j8fA_|8.3e-75|40.9|252/0|c.31.1.5|1/1|DHS-like NAD/FAD-binding domain| OP:NHOMO 1069 OP:NHOMOORG 668 OP:PATTERN 11---11111111111-12222221--1---11----------------1---11111111---1--1 1-1-22-222211112211-12112211111222222111-1111122-111111121--1221221121111111111-1111----1111-111--------1-1-1----------------1----1-----11133---411------------------------------------11-11---111111111111111111111111111222-1--1111111111111111111111111111-1111111111111121-1--11----------1--------------------------1----------1-1111111111111111111-11111111-1---121-11-112-111111-111-----11222---11111--------------1----1--1-------------11-1-----1--------------1-----1------------------------------1111-11-112112222222122122222122212212--1111-2222---1---1----11----------212122111---11--------11-1211212322----------11--111111--1-1--11-121-11---------1-1111-111-1--1-21-------1-1-11-11111111-1-1111111111111111111--1----1----------------111111111-111111111111-------------1122-----1-----1---1111-1---1-3-22221212-1--22433----------1--1----------1111111111-------11111----------1-1----------1--------------1111111111-1- 11--1-3-523-22323112332434221111-111233333312222323333113122212-1-12--11221111221-1------221311431311211111292A86654511121227524-6H4-5452322623321322222143332344447332511365631223D---133222-544211121 ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 271 STR:RPRED 89.4 SQ:SECSTR ####################ccHHHHHHHHHccEEEEEcGGGTGGGTccccccTTcHHHHHHcHHHccHHHHHHcHHHHHHHHHHHTGGGGGccccHHHHHHHHHHHTTcccEEEEcccccHHHHHTcccEEETTEEEEEEEETTTccEEEHHcccEEEcccccccGGGTTcccccTTccHHHHHGGGccccccTTTcccEEEEEcccTccccHHHHHHHHHHHHHccEEEEEccccccTTGGGHHHHHHHTTcEEEEEcccccTTTTTccEEEcccHHHHHHHHHHHHTc############ DISOP:02AL 1-3, 296-303| PSIPRED ccccccccccccccccHHHHHHHHHHHHHHcccEEEEEccccccccccccccccccccccccHHHHHcHHHHHHcHHHHHHHHHHHHHHHHHccccHHHHHHHHHHHcccEEEEEEEccccHHHHcccccEEEEEccccEEEEccccccccHHHHHHHHHHccccccHHHHHHcccccccccHHHcccccccccccccccccccEEEccccccHHHHHHHHHHHHcccEEEEEcccccccHHHHHHHHHHHccccEEEEcccccccccEEEEEEEccHHHHHHHHHHHccccccccccccccc //