[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Streptomyces avermitilis MA-4680 (save0)
Gene : BAC68248.1
DDBJ      :             hypothetical protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  2/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
:143 amino acids
:PSIPRED
:DISOPRED
:HMM:PFM   13->48 PF02604 * PhdYeFM 8.5e-06 33.3 36/75  
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID BAC68248.1 GT:GENE BAC68248.1 GT:PRODUCT hypothetical protein GT:DATABASE GIB00135CH01 GT:ORG save0 GB:ACCESSION GIB00135CH01 GB:LOCATION 680351..680782 GB:FROM 680351 GB:TO 680782 GB:DIRECTION + GB:PRODUCT hypothetical protein GB:PROTEIN_ID BAC68248.1 LENGTH 143 SQ:AASEQ MDFELIEGAPEFGCLIAEVEETGERIRLTADGEPAGVLLAAAELATLEYWAARHNKGARPQDEPADEYPPGPTSYGPYIGYSHPHGGMTLTRGRLVVAELRDAETVAWLEEQAMYGRQGYMGPKQSAAFAEFLARQTPVGDEH GT:EXON 1|1-143:0| SEG 33->52|epagvllaaaelatleywaa| HM:PFM:NREP 1 HM:PFM:REP 13->48|PF02604|8.5e-06|33.3|36/75|PhdYeFM| OP:NHOMO 2 OP:NHOMOORG 2 OP:PATTERN -------------------------------------------------------------------- -------------------------------------------------------------------11------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------ ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 64-66, 138-143| PSIPRED ccccccccccHHHHHHHHHHHcccEEEEEEEccccEEEEHHHHHHHHHHHHHHccccccccccccccccccccccccEEEEEcccccEEEEcccEEEHHHccHHHHHHHHHHHHHHHccccccHHHHHHHHHHHHHccccccc //