[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Streptomyces avermitilis MA-4680 (save0)
Gene : BAC68263.1
DDBJ      :             hypothetical protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  1/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
:209 amino acids
:PSIPRED
:DISOPRED

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID BAC68263.1 GT:GENE BAC68263.1 GT:PRODUCT hypothetical protein GT:DATABASE GIB00135CH01 GT:ORG save0 GB:ACCESSION GIB00135CH01 GB:LOCATION complement(700072..700701) GB:FROM 700072 GB:TO 700701 GB:DIRECTION - GB:PRODUCT hypothetical protein GB:PROTEIN_ID BAC68263.1 LENGTH 209 SQ:AASEQ MNATVTKKAGKGATDGVVSEMATYFHIKPGHEQECAAACQRMVEALKQAPMAATIKTGLRDTRHVIFNNGTELLWATTFETEWEPYIDDAFLTVGFEHFVDWMQHTTEWDTKIAPWIEKSGGLESLTGDKTREGFDEHIIANMAGMRWILQDGQQKATAYWNPVSSLTMSEITKAERINAAFQEVLDDPAAEEALQHPALKPLLAQAAS GT:EXON 1|1-209:0| OP:NHOMO 3 OP:NHOMOORG 1 OP:PATTERN -------------------------------------------------------------------- -------------------------------------------------------------------3------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 1-11, 208-209| PSIPRED ccccccccccccccccEEEEEEEEEEEcccHHHHHHHHHHHHHHHHHHccHHHHHHHHHHHEEEEEEEcccEEEEEEEcccccHHHHHHHHHHHHHHHHHHHHHHHcccccccccHHHHHccHHHEEccccccccccHHHccccHHEEEHccccccEEEEEccccccHHHHHHHHHHHHHHHHHHcccHHHHHHHHcccccHHHccccc //