[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Streptomyces avermitilis MA-4680 (save0)
Gene : BAC68268.1
DDBJ      :             hypothetical protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  1/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
:114 amino acids
:PSIPRED
:DISOPRED
:BLT:SWISS 30->100 KITH_EBVG 7e-04 34.8 %

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID BAC68268.1 GT:GENE BAC68268.1 GT:PRODUCT hypothetical protein GT:DATABASE GIB00135CH01 GT:ORG save0 GB:ACCESSION GIB00135CH01 GB:LOCATION 707738..708082 GB:FROM 707738 GB:TO 708082 GB:DIRECTION + GB:PRODUCT hypothetical protein GB:PROTEIN_ID BAC68268.1 LENGTH 114 SQ:AASEQ MPGTPRTPNDAANGAPAKTSARRSRTRIGRLPCGNAARATSSVRSGIFGNPSGCRDIHTTHTTARQVNGRADDHPAPTACPPQPRGIAQQSPGPPQATSWPLSRPAHPGRDQIR GT:EXON 1|1-114:0| BL:SWS:NREP 1 BL:SWS:REP 30->100|KITH_EBVG|7e-04|34.8|66/607| OP:NHOMO 1 OP:NHOMOORG 1 OP:PATTERN -------------------------------------------------------------------- -------------------------------------------------------------------1------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 1-25, 83-98, 107-114| PSIPRED ccccccccccccccccccHHHHHHHHHHcccccccHHHHHHHHHHcccccccccccccccHHHHHHcccccccccccccccccccccccccccccccccccccccccccccccc //