Streptomyces avermitilis MA-4680 (save0)
Gene : BAC68269.1
DDBJ      :             hypothetical protein

Homologs  Archaea  0/68 : Bacteria  1/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
:153 amino acids

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID BAC68269.1 GT:GENE BAC68269.1 GT:PRODUCT hypothetical protein GT:DATABASE GIB00135CH01 GT:ORG save0 GB:ACCESSION GIB00135CH01 GB:LOCATION 708335..708796 GB:FROM 708335 GB:TO 708796 GB:DIRECTION + GB:PRODUCT hypothetical protein GB:PROTEIN_ID BAC68269.1 LENGTH 153 SQ:AASEQ MKLTKRISLAAASAAVAGGALLGAGGTASAAVPESAHIERPAVSIKADDYREDRGVNYRHNSEEDYRRDGYRARQHSDHFSDSDRYDRRGHSYYWDDEDRCWKHDSNYRYDWDRSDRRDSNRDDRDWNRYDHDWNRYDHDSNRSNHDRVLDNR GT:EXON 1|1-153:0| SEG 8->31|slaaasaavaggallgaggtasaa| SEG 105->136|dsnyrydwdrsdrrdsnrddrdwnrydhdwnr| OP:NHOMO 1 OP:NHOMOORG 1 OP:PATTERN -------------------------------------------------------------------- -------------------------------------------------------------------1------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 1-4, 6-7, 72-85, 115-127, 146-153| PSIPRED ccccHHHHHHHHHHHHHcccEEccccccccccccccccccccEEccccHHHccccccHHHHHHHHHHHHHHHHHHHHHHHcccccHHHcccccccccccccccccccccccccccccccccccccccccccccHHHHccccccccHHHccccc //