[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Streptomyces avermitilis MA-4680 (save0)
Gene : BAC68276.1
DDBJ      :             putative TetR-family transcriptional regulator
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  50/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
a.121.1a.4.1
:211 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   13->117 2hytA PDBj 8e-09 43.3 %
:RPS:PDB   18->192 3br5E PDBj 2e-18 12.0 %
:RPS:SCOP  14->85 3c07A1  a.4.1.9 * 3e-13 23.6 %
:RPS:SCOP  89->193 2genA2  a.121.1.1 * 2e-05 17.1 %
:HMM:SCOP  6->94 1t33A1 a.4.1.9 * 2.1e-19 33.0 %
:HMM:SCOP  89->197 1rktA2 a.121.1.1 * 7.5e-08 31.2 %
:RPS:PFM   22->67 PF00440 * TetR_N 2e-04 41.3 %
:HMM:PFM   22->68 PF00440 * TetR_N 1.4e-15 38.3 47/47  
:BLT:SWISS 15->90 DHAR_MYCSX 2e-07 32.9 %
:BLT:SWISS 89->205 ARLY_BRUSU 1e-04 34.0 %

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID BAC68276.1 GT:GENE BAC68276.1 GT:PRODUCT putative TetR-family transcriptional regulator GT:DATABASE GIB00135CH01 GT:ORG save0 GB:ACCESSION GIB00135CH01 GB:LOCATION 717140..717775 GB:FROM 717140 GB:TO 717775 GB:DIRECTION + GB:PRODUCT putative TetR-family transcriptional regulator GB:NOTE PF00440: Bacterial regulatory proteins, tetR family GB:PROTEIN_ID BAC68276.1 LENGTH 211 SQ:AASEQ MPTSAPPKNRFERRRAETRQALVRAARQILAETGDTSASIQAIAERADVGFGSFYNHFESKTELFDAAVTDALDEFGQVIDERVEGIDDPAELVAAGFRLTARMADSHPELMRILRDRGLAYIHSARGLAPRALRDLENGIASGRFTCRNATTALSALGGTLMSLVALRLARPDLDGDEAASDLAEMVLRMLGVPPDDAHQVTRRPLPDLD GT:EXON 1|1-211:0| BL:SWS:NREP 2 BL:SWS:REP 15->90|DHAR_MYCSX|2e-07|32.9|76/198| BL:SWS:REP 89->205|ARLY_BRUSU|1e-04|34.0|103/466| BL:PDB:NREP 1 BL:PDB:REP 13->117|2hytA|8e-09|43.3|97/188| RP:PDB:NREP 1 RP:PDB:REP 18->192|3br5E|2e-18|12.0|175/186| RP:PFM:NREP 1 RP:PFM:REP 22->67|PF00440|2e-04|41.3|46/47|TetR_N| HM:PFM:NREP 1 HM:PFM:REP 22->68|PF00440|1.4e-15|38.3|47/47|TetR_N| GO:PFM:NREP 2 GO:PFM GO:0003700|"GO:transcription factor activity"|PF00440|IPR001647| GO:PFM GO:0006355|"GO:regulation of transcription, DNA-dependent"|PF00440|IPR001647| RP:SCP:NREP 2 RP:SCP:REP 14->85|3c07A1|3e-13|23.6|72/75|a.4.1.9| RP:SCP:REP 89->193|2genA2|2e-05|17.1|105/118|a.121.1.1| HM:SCP:REP 6->94|1t33A1|2.1e-19|33.0|88/0|a.4.1.9|1/1|Homeodomain-like| HM:SCP:REP 89->197|1rktA2|7.5e-08|31.2|109/0|a.121.1.1|1/1|Tetracyclin repressor-like, C-terminal domain| OP:NHOMO 59 OP:NHOMOORG 50 OP:PATTERN -------------------------------------------------------------------- ----1--11111--11--------1-------1----121---2-----------------------3------------------------------------------------------------------------------------------------------------------------------11111--------------------------------1----------------------------------------------------------------------------------------------1---------------------------1-111-----------------1--1-------------1-------------------------13----1---------11-1----------------------------------------------------------11------21111------11-3------1--1-1----------------------------------------1--------------------------1--------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 205 STR:RPRED 97.2 SQ:SECSTR ####cTccccccccHHHcHHHHHHHHHHHHHHHTTTcccHHHHHHHTTccHHHHHHHcccHHHHHHHHHHHHHHHHHHHHHHHHTTcccHHHHHHHHHHHHHHccccTTTTHHHHHHHHHTcccHHHHHHHHHHHHHHHHHTTTccccccHHHHHHHHHHHHHHHHHTcTTccHHHHHHHHHHHHHHHHHTccccHHHHHHHHcccHHH## DISOP:02AL 1-21, 209-211| PSIPRED ccccccccccccHHHHHHHHHHHHHHHHHHHHcccccccHHHHHHHHccccccHHcccccHHHHHHHHHHHHHHHHHHHHHHHHcccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccHHHHHHHHHHHHHHHHHHHHHHccccccccHHHHHHHHHHHHHHHHHHHHHcccccHHHHHHHHHHHHHHHHcccHHHHHHcccccccccc //