[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Streptomyces avermitilis MA-4680 (save0)
Gene : BAC68281.1
DDBJ      :             hypothetical protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  43/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
:268 amino acids
:PSIPRED
:DISOPRED
:RPS:PFM   93->266 PF03691 * UPF0167 4e-41 45.6 %
:HMM:PFM   93->268 PF03691 * UPF0167 3.9e-69 48.6 173/176  
:BLT:SWISS 96->266 Y2317_MYCBO 6e-41 47.1 %
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID BAC68281.1 GT:GENE BAC68281.1 GT:PRODUCT hypothetical protein GT:DATABASE GIB00135CH01 GT:ORG save0 GB:ACCESSION GIB00135CH01 GB:LOCATION 722855..723661 GB:FROM 722855 GB:TO 723661 GB:DIRECTION + GB:PRODUCT hypothetical protein GB:NOTE PF03691: Uncharacterised protein family (UPF0167) GB:PROTEIN_ID BAC68281.1 LENGTH 268 SQ:AASEQ MERGQRRHGPVGRADGAELGQSAPCRRVGASTSPASTRAPTLPSTSRTSTSPLDHEPACGQTAAHEVHGRARLRAGHRGRDGPLFAAAGSAVSVSLPHFRYHPDPVASGSIGESAEVCACCNRSTGWIYTATFYTAHDVSGSFCPWCIADGTAAERFEGEFTDPYGLDGISQETLVQVTRRTPGLHAWQDPHWLVHCNDAAAFIGEVGYTELAAHPEALDQLRLDLRMGGWNDATQLEHFLTHLGQGASAMLFRCTVCGTHLAYADAS GT:EXON 1|1-268:0| BL:SWS:NREP 1 BL:SWS:REP 96->266|Y2317_MYCBO|6e-41|47.1|170/187| SEG 31->53|stspastraptlpstsrtstspl| SEG 68->82|hgrarlraghrgrdg| RP:PFM:NREP 1 RP:PFM:REP 93->266|PF03691|4e-41|45.6|171/175|UPF0167| HM:PFM:NREP 1 HM:PFM:REP 93->268|PF03691|3.9e-69|48.6|173/176|UPF0167| OP:NHOMO 43 OP:NHOMOORG 43 OP:PATTERN -------------------------------------------------------------------- -1---------------11-1-----11111------------------------------------1-------------------------------------------------------------------------------------------------------------------------------------------------1-------1---------1------------------------------------------------------1--------------------------------------------------1--------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1----------------1------------------------------------------------------------1--------------------------------------------1--1-1-------------------------1---1---11--111---1-1---111111------------------------------1------------------------------------------------------------1111-------------------------------------11----------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 1-13, 32-52, 267-268| PSIPRED cccccccccccccccHHHHcccccHHHccccccccccccccccccccccccccccccccccHHHHHHHHHHHHHcccccccccEEEEcccEEEEEcccEEEccccccccccccHHHHHHHHcccccEEEEccEEEHHHcccccccEEEccccHHHHccEEEccccccccccHHHHHHHHHHcccccccccHHHHHHHccHHEEEcHHHHHHHHHHHHHHHHHHHHHHccccccHHHHHHHHHHccccccEEEEEHHHHHHHHHccccc //