[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Streptomyces avermitilis MA-4680 (save0)
Gene : BAC68283.1
DDBJ      :             hypothetical protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  4/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
d.38.1
:227 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:RPS:PDB   148->211 3d6xE PDBj 6e-07 9.4 %
:RPS:SCOP  150->208 1q6wA  d.38.1.4 * 2e-10 25.4 %
:HMM:SCOP  149->208 2b3nA1 d.38.1.4 * 1.7e-13 39.0 %
:HMM:PFM   159->207 PF01575 * MaoC_dehydratas 1.8e-05 30.6 49/123  
:BLT:SWISS 162->197 HTD2_YEAST 6e-04 41.7 %
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID BAC68283.1 GT:GENE BAC68283.1 GT:PRODUCT hypothetical protein GT:DATABASE GIB00135CH01 GT:ORG save0 GB:ACCESSION GIB00135CH01 GB:LOCATION complement(724687..725370) GB:FROM 724687 GB:TO 725370 GB:DIRECTION - GB:PRODUCT hypothetical protein GB:PROTEIN_ID BAC68283.1 LENGTH 227 SQ:AASEQ MAGDERAQPLLPHAEGGGQVVVFGEQPGQQFGARDAYAKPCPEYRGHAPGEVAEQDDPFATALCKATGPLDDMADTLLARARPTGMRADDTTCLLVSPLSRAPAVAAPTGHHRRATAGPRGGSGVVEPVPGAENGDRLLEFAGVVVSINYQVGDTLPRLKHTVTTFQLFRYSAVTWNPHRIHFDEPYAREEGHGGLVAHSHLRAALALCHRGSRPQVARDEGCLPPA GT:EXON 1|1-227:0| BL:SWS:NREP 1 BL:SWS:REP 162->197|HTD2_YEAST|6e-04|41.7|36/100| SEG 15->32|egggqvvvfgeqpgqqfg| RP:PDB:NREP 1 RP:PDB:REP 148->211|3d6xE|6e-07|9.4|64/132| HM:PFM:NREP 1 HM:PFM:REP 159->207|PF01575|1.8e-05|30.6|49/123|MaoC_dehydratas| RP:SCP:NREP 1 RP:SCP:REP 150->208|1q6wA|2e-10|25.4|59/151|d.38.1.4| HM:SCP:REP 149->208|2b3nA1|1.7e-13|39.0|59/0|d.38.1.4|1/1|Thioesterase/thiol ester dehydrase-isomerase| OP:NHOMO 4 OP:NHOMOORG 4 OP:PATTERN -------------------------------------------------------------------- ---------------1----------------------1----------------------------1-----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 72 STR:RPRED 31.7 SQ:SECSTR ###################################################################################################################################################ccHHHHTTccccTTcccccEEEEEETTTEEEEEEEccTTcTHHHccHHHHHHHHHHHHHHHHHcHTccccEE######## DISOP:02AL 1-6, 226-227| PSIPRED ccccccccccccccccccEEEEEcccccHHHccccccccccHHHccccccccccccccHHHHHHHccccHHHHHHHHHHHcccccccccccEEEEEcccccccEEccccccccccccccccccccccccccccccccHHHHccEEEEccccccccccccEEcccHHHHHHHHHHHcccEEEEEcHHHHHHccccccEEccHHHHHHHHHHcccccEEEEcccccccc //