[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Streptomyces avermitilis MA-4680 (save0)
Gene : BAC68287.1
DDBJ      :             putative TetR-family transcriptional regulator
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  41/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
a.121.1a.4.1
:265 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   17->104 2optB PDBj 1e-10 38.6 %
:RPS:PDB   19->178 3b81A PDBj 2e-12 14.3 %
:RPS:SCOP  19->90 1jt0A1  a.4.1.9 * 2e-11 25.8 %
:RPS:SCOP  83->212 1a6iA2  a.121.1.1 * 7e-15 17.6 %
:HMM:SCOP  16->87 1zk8A1 a.4.1.9 * 7.7e-11 30.6 %
:HMM:SCOP  85->214 2g7gA2 a.121.1.1 * 2.1e-16 24.2 %
:RPS:PFM   23->66 PF00440 * TetR_N 1e-04 43.2 %
:HMM:PFM   25->66 PF00440 * TetR_N 2.9e-14 38.1 42/47  
:HMM:PFM   84->209 PF02909 * TetR_C 6.6e-08 22.2 126/139  
:BLT:SWISS 18->104 TETR2_ECOLX 1e-09 42.5 %
:TM
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID BAC68287.1 GT:GENE BAC68287.1 GT:PRODUCT putative TetR-family transcriptional regulator GT:DATABASE GIB00135CH01 GT:ORG save0 GB:ACCESSION GIB00135CH01 GB:LOCATION complement(732025..732822) GB:FROM 732025 GB:TO 732822 GB:DIRECTION - GB:PRODUCT putative TetR-family transcriptional regulator GB:NOTE PF00440: Bacterial regulatory proteins, tetR family GB:PROTEIN_ID BAC68287.1 LENGTH 265 SQ:AASEQ MERAKRTPRGTRKRDVPLTEAGICTSALRLIDADGVEALTMRKLAAALDANPMSLYHHVPNKEALLGGVARMVGARFRTVTLEDAPWQERVRLLATDFRTLAHRHPNLMAYSFSQPDFIQPEDPFWVALTAVLAAAGVPQSEIPQLAALVCAVVIGVMIAELNGALHRWSNLQPATPASGEDGPTNEGFGEDRMFRLVLDTIISGLESRLTADHAGGREGQPPQNSGCASGRIPRQLRPPAAHCEGESPGNPVSGMAAGLDPEVQ GT:EXON 1|1-265:0| BL:SWS:NREP 1 BL:SWS:REP 18->104|TETR2_ECOLX|1e-09|42.5|87/207| TM:NTM 2 TM:REGION 119->141| TM:REGION 144->166| SEG 127->136|valtavlaaa| BL:PDB:NREP 1 BL:PDB:REP 17->104|2optB|1e-10|38.6|88/205| RP:PDB:NREP 1 RP:PDB:REP 19->178|3b81A|2e-12|14.3|154/181| RP:PFM:NREP 1 RP:PFM:REP 23->66|PF00440|1e-04|43.2|44/47|TetR_N| HM:PFM:NREP 2 HM:PFM:REP 25->66|PF00440|2.9e-14|38.1|42/47|TetR_N| HM:PFM:REP 84->209|PF02909|6.6e-08|22.2|126/139|TetR_C| GO:PFM:NREP 2 GO:PFM GO:0003700|"GO:transcription factor activity"|PF00440|IPR001647| GO:PFM GO:0006355|"GO:regulation of transcription, DNA-dependent"|PF00440|IPR001647| RP:SCP:NREP 2 RP:SCP:REP 19->90|1jt0A1|2e-11|25.8|62/71|a.4.1.9| RP:SCP:REP 83->212|1a6iA2|7e-15|17.6|119/127|a.121.1.1| HM:SCP:REP 16->87|1zk8A1|7.7e-11|30.6|72/0|a.4.1.9|1/1|Homeodomain-like| HM:SCP:REP 85->214|2g7gA2|2.1e-16|24.2|124/0|a.121.1.1|1/1|Tetracyclin repressor-like, C-terminal domain| OP:NHOMO 55 OP:NHOMOORG 41 OP:PATTERN -------------------------------------------------------------------- ----2---------2-1--------1-------1112232-11322----11-11-----111-1-12212---------------------------------------------------------------------------------------------1--------------------1-----------------------------------------------------------------------1-----------1---------------------------------------------------------------------------------------------------------------------------1-------------------------1-------------------------------------------1---------------------------------1--------1111--------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 212 STR:RPRED 80.0 SQ:SECSTR #####cHHHHHHccHHHHHHHHHHHHHHHHHHHHccTTccHHHHHHHHTccHHHHHTTcccHHHHHHHHHHHHHHHHHHHccTTccHHHHHHHHHTccccccHHHHHHHHHHHTTHHHHHHHHHHHHHHHHHHHHHTccccccHHHHHccHHHHHHHHHTTTcHHHHTccGGGHHHHHHHHTHHHHHcccHHHHHHHHHHHHHHHHcGGHcccHHTc################################################ DISOP:02AL 1-21, 212-250, 263-265| PSIPRED cccccccccccccccHHHHHHHHHHHHHHHHHHcccccccHHHHHHHHccccccEEEEcccHHHHHHHHHHHHHHHHHHHccccccHHHHHHHHHHHHHHHHHHcHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccHHHHccccccccccHHHHHHHHHHHHHHHHHHHHHcccccccccccHHHHccccccccHHccccccccccccccccHHHHHHccccccc //