[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Streptomyces avermitilis MA-4680 (save0)
Gene : BAC68289.1
DDBJ      :             hypothetical protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  7/915 : Eukaryota  2/199 : Viruses  0/175   --->[See Alignment]
d.58.4
:109 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:RPS:PDB   4->108 2ap6A PDBj 3e-13 25.3 %
:RPS:SCOP  4->108 1vqsA  d.58.4.13 * 2e-04 24.2 %
:HMM:SCOP  2->109 1vqsA_ d.58.4.13 * 3.8e-12 26.2 %
:HMM:PFM   4->107 PF07978 * NIPSNAP 2.8e-22 23.8 101/101  

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID BAC68289.1 GT:GENE BAC68289.1 GT:PRODUCT hypothetical protein GT:DATABASE GIB00135CH01 GT:ORG save0 GB:ACCESSION GIB00135CH01 GB:LOCATION complement(734105..734434) GB:FROM 734105 GB:TO 734434 GB:DIRECTION - GB:PRODUCT hypothetical protein GB:NOTE PF07978: NIPSNAP GB:PROTEIN_ID BAC68289.1 LENGTH 109 SQ:AASEQ MSQYQLRVYTLRSPEALVAYENIWSQHIPGMAKHRITTHGVWTVPAAPGSEEPQLYALVSYRDADDVQERLEAYLSSPEFRADMEGFDISQIVGVAESVLTPTADSPLR GT:EXON 1|1-109:0| RP:PDB:NREP 1 RP:PDB:REP 4->108|2ap6A|3e-13|25.3|95/100| HM:PFM:NREP 1 HM:PFM:REP 4->107|PF07978|2.8e-22|23.8|101/101|NIPSNAP| RP:SCP:NREP 1 RP:SCP:REP 4->108|1vqsA|2e-04|24.2|99/110|d.58.4.13| HM:SCP:REP 2->109|1vqsA_|3.8e-12|26.2|103/0|d.58.4.13|1/1|Dimeric alpha+beta barrel| OP:NHOMO 9 OP:NHOMOORG 9 OP:PATTERN -------------------------------------------------------------------- -------------------------1-------1111------------------------------1-------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ----------------------------------------------------1--------------------------------------------------------1----------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 95 STR:RPRED 87.2 SQ:SECSTR ###EEEEEEEEc#TTcHHHHHHHHHHHHHHHHHHHcEEEEEEEccccc###ccEEEEEEEEccHHHHHHH#HHHHHcHHHGGGTTTTEEEE#####EEEEcccTTccc# DISOP:02AL 1-3, 104-109| PSIPRED ccEEEEEEEEEccHHHHHHHHHHHHHHcccccccccEEEEEEEEcccccccccEEEEEEEccccccHHHHHHHHHcccccccccccccHHHHHHHHHHHcccccccccc //