[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Streptomyces avermitilis MA-4680 (save0)
Gene : BAC68291.1
DDBJ      :             hypothetical protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  1/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
:114 amino acids
:PSIPRED
:DISOPRED
:HMM:PFM   23->69 PF11239 * DUF3040 2.7e-05 26.1 46/82  
:TM
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID BAC68291.1 GT:GENE BAC68291.1 GT:PRODUCT hypothetical protein GT:DATABASE GIB00135CH01 GT:ORG save0 GB:ACCESSION GIB00135CH01 GB:LOCATION complement(734950..735294) GB:FROM 734950 GB:TO 735294 GB:DIRECTION - GB:PRODUCT hypothetical protein GB:PROTEIN_ID BAC68291.1 LENGTH 114 SQ:AASEQ MEGFAQAAPDAAHRLHAADGADRTHQEGKTMKRLTRRVAVTAFCVAVAGVAALGAGGTASAATSASVHGQRPAVSVDAGDYRWDHGVGYLLELGYSWDEIRGWHHDGRDEISGC GT:EXON 1|1-114:0| TM:NTM 1 TM:REGION 38->60| SEG 5->19|aqaapdaahrlhaad| SEG 38->67|vavtafcvavagvaalgaggtasaatsasv| HM:PFM:NREP 1 HM:PFM:REP 23->69|PF11239|2.7e-05|26.1|46/82|DUF3040| OP:NHOMO 1 OP:NHOMOORG 1 OP:PATTERN -------------------------------------------------------------------- -------------------------------------------------------------------1------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 1-7, 110-111| PSIPRED ccccHHcccHHHHHHHccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccccccccccccccccEEEEcccccccccccEEEHHccccHHHHcccccccccccccc //