[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Streptomyces avermitilis MA-4680 (save0)
Gene : BAC68295.1
DDBJ      :             putative TetR-family transcriptional regulator
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  20/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
a.121.1a.4.1
:211 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   46->95 3bniB PDBj 2e-05 44.0 %
:RPS:PDB   20->192 3dcfB PDBj 4e-10 13.3 %
:RPS:SCOP  20->84 1z77A1  a.4.1.9 * 2e-08 20.0 %
:HMM:SCOP  6->94 1t33A1 a.4.1.9 * 8.6e-20 38.6 %
:HMM:SCOP  87->195 1pb6A2 a.121.1.1 * 6.5e-06 18.7 %
:HMM:PFM   22->68 PF00440 * TetR_N 4.3e-14 36.2 47/47  
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID BAC68295.1 GT:GENE BAC68295.1 GT:PRODUCT putative TetR-family transcriptional regulator GT:DATABASE GIB00135CH01 GT:ORG save0 GB:ACCESSION GIB00135CH01 GB:LOCATION complement(738601..739236) GB:FROM 738601 GB:TO 739236 GB:DIRECTION - GB:PRODUCT putative TetR-family transcriptional regulator GB:NOTE PF00440: Bacterial regulatory proteins, tetR family GB:PROTEIN_ID BAC68295.1 LENGTH 211 SQ:AASEQ MPMPAPRRNRFERRRAETRQALVRAARQVLAESGGASASIHAIAERADVGLGSFYNHFAGKPDLFDAAVADALEEYAQAVDERLHGVDDPAERVAGGVRLSARMAASYPEIMQILCHSQLGRIYAGDGLAPRAKRDVEQGMAAGRFTVADPVIALTLLNGGLLALLELWCNQPEADSDQAAGAMAETILHMLGLSPDEARDLAWRPLPAAA GT:EXON 1|1-211:0| SEG 4->19|paprrnrferrraetr| SEG 31->45|aesggasasihaiae| SEG 154->168|altllnggllallel| BL:PDB:NREP 1 BL:PDB:REP 46->95|3bniB|2e-05|44.0|50/171| RP:PDB:NREP 1 RP:PDB:REP 20->192|3dcfB|4e-10|13.3|173/181| HM:PFM:NREP 1 HM:PFM:REP 22->68|PF00440|4.3e-14|36.2|47/47|TetR_N| RP:SCP:NREP 1 RP:SCP:REP 20->84|1z77A1|2e-08|20.0|65/75|a.4.1.9| HM:SCP:REP 6->94|1t33A1|8.6e-20|38.6|88/0|a.4.1.9|1/1|Homeodomain-like| HM:SCP:REP 87->195|1pb6A2|6.5e-06|18.7|107/0|a.121.1.1|1/1|Tetracyclin repressor-like, C-terminal domain| OP:NHOMO 22 OP:NHOMOORG 20 OP:PATTERN -------------------------------------------------------------------- ----1---111---11--------1-------1-----11---1-----------------------2-----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------11111------11-2----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 192 STR:RPRED 91.0 SQ:SECSTR ###################HHHHHHHHHHHHHTcTTTccHHHHHHHHTccHHHHHHHcccHHHHHHHHHHHHHHHHHHHHHHHHTccccHHHHHHHHHHHHHHHHHHcHHHHHHHHcHHHHHHHHHHHHHHHHHHHHHHHHHTTccccccHHHHHHHHHHHHHTHHHHccTTccccHHHHHHHHHHHHHHccccHHHHHHcTTTHHHHHHH DISOP:02AL 1-21, 200-204, 209-211| PSIPRED cccccccccccccHHHHHHHHHHHHHHHHHHHcccccccHHHHHHHHccccccHHcccccHHHHHHHHHHHHHHHHHHHHHHHHcccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccccccHHHHHHHHHHHHHHHHHHHHccccccHHHHHHHHHHHHHHHHccccHHHHHcccccccccc //