[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Streptomyces avermitilis MA-4680 (save0)
Gene : BAC68314.1
DDBJ      :             hypothetical protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  45/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
a.28.1
:85 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   1->74 2fq1B PDBj 2e-10 41.7 %
:RPS:PDB   5->85 2cq8A PDBj 4e-06 25.0 %
:RPS:SCOP  4->85 1klpA  a.28.1.1 * 1e-05 22.0 %
:HMM:SCOP  1->83 1klpA_ a.28.1.1 * 8.8e-09 31.3 %
:HMM:PFM   11->69 PF00550 * PP-binding 3.1e-12 35.6 59/67  
:BLT:SWISS 6->78 DHBB_BACSU 2e-16 46.6 %

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID BAC68314.1 GT:GENE BAC68314.1 GT:PRODUCT hypothetical protein GT:DATABASE GIB00135CH01 GT:ORG save0 GB:ACCESSION GIB00135CH01 GB:LOCATION complement(758706..758963) GB:FROM 758706 GB:TO 758963 GB:DIRECTION - GB:PRODUCT hypothetical protein GB:NOTE nrps6 gene cluster, PF00550: Phosphopantetheine attachment site GB:PROTEIN_ID BAC68314.1 LENGTH 85 SQ:AASEQ MPAPLTLEGFRADLAEFLYQRPDEVDLEENPMDAGLDSLRIVTLLERWRETGADVTFVELAECTSFAQWWQLLSARQRGADHADA GT:EXON 1|1-85:0| BL:SWS:NREP 1 BL:SWS:REP 6->78|DHBB_BACSU|2e-16|46.6|73/312| BL:PDB:NREP 1 BL:PDB:REP 1->74|2fq1B|2e-10|41.7|72/279| RP:PDB:NREP 1 RP:PDB:REP 5->85|2cq8A|4e-06|25.0|80/110| HM:PFM:NREP 1 HM:PFM:REP 11->69|PF00550|3.1e-12|35.6|59/67|PP-binding| RP:SCP:NREP 1 RP:SCP:REP 4->85|1klpA|1e-05|22.0|82/115|a.28.1.1| HM:SCP:REP 1->83|1klpA_|8.8e-09|31.3|83/115|a.28.1.1|1/1|ACP-like| OP:NHOMO 45 OP:NHOMOORG 45 OP:PATTERN -------------------------------------------------------------------- ----------------1--------------------------------------------------1-11-------------------------------------------------------------------------1------------------------------------------------1111111111111111--11-1111----1------------------------------------------------------------------------------------------------------------------------------------------------------1---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------11-----------------------------11---------------------------------------------------------------------------------1---------------------------------------------------------1---------------------------1-------------------------------1111111--11------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 85 STR:RPRED 100.0 SQ:SECSTR ccHHHHHHHHHHHHHHHcccccccccTTccHHHHHccTTHHHHHHHHHHHHcccccHHHHHHcccHHHHHHHHHHHHHHcccccc DISOP:02AL 1-3, 77-85| PSIPRED ccccccHHHHHHHHHHHHcccHHHccccccHHHHcHHHHHHHHHHHHHHHccccccHHHHHHcccHHHHHHHHHHHccccccccc //