[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Streptomyces avermitilis MA-4680 (save0)
Gene : BAC68316.1
DDBJ      :             hypothetical protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  14/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
:172 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   7->172 2pfcA PDBj 2e-25 39.7 %
:RPS:PDB   65->135 2eabB PDBj 7e-04 10.0 %
:RPS:PFM   15->167 PF10862 * DUF2662 5e-36 49.0 %
:HMM:PFM   15->168 PF10862 * DUF2662 4.6e-74 55.9 152/157  
:BLT:SWISS 7->172 Y101_MYCBO 5e-26 38.8 %

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID BAC68316.1 GT:GENE BAC68316.1 GT:PRODUCT hypothetical protein GT:DATABASE GIB00135CH01 GT:ORG save0 GB:ACCESSION GIB00135CH01 GB:LOCATION complement(760605..761123) GB:FROM 760605 GB:TO 761123 GB:DIRECTION - GB:PRODUCT hypothetical protein GB:NOTE nrps6 gene cluster GB:PROTEIN_ID BAC68316.1 LENGTH 172 SQ:AASEQ MTTAQHPTDEDLLARVLVPYKDHCKYLRSAVVTESDTGRAVARCEFAIPESCYIDDTGHLNSVEVNICYNQMMYYLVAKSVKEGLLAGFESWTLDDFWKHQLPDILIARFASNFRRPVNPRAFSGEMEFQSVTRRAPAGGIPFLHAETAYRYWDADSGRCDGEAVLAFVNIP GT:EXON 1|1-172:0| BL:SWS:NREP 1 BL:SWS:REP 7->172|Y101_MYCBO|5e-26|38.8|160/183| BL:PDB:NREP 1 BL:PDB:REP 7->172|2pfcA|2e-25|39.7|156/160| RP:PDB:NREP 1 RP:PDB:REP 65->135|2eabB|7e-04|10.0|70/881| RP:PFM:NREP 1 RP:PFM:REP 15->167|PF10862|5e-36|49.0|151/158|DUF2662| HM:PFM:NREP 1 HM:PFM:REP 15->168|PF10862|4.6e-74|55.9|152/157|DUF2662| OP:NHOMO 14 OP:NHOMOORG 14 OP:PATTERN -------------------------------------------------------------------- --------------1--11-1-111-111111-----------------------------------1------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 157 STR:RPRED 91.3 SQ:SECSTR ######cccTTHHHHHcHHHHTTcccEEEEEEEEcccc#EEEEEEEcccccccccccccccHHHcccccHHHHccccccEEEETEEccccccccEEEEEEEETTTTEEEEEEEETTEEEEEEEEEETTTTEEEEE#######cEEEEEEEEEEc#cccEEEEEEEEEEcccc DISOP:02AL 1-5| PSIPRED ccccccccHHHHHHHHHHHHHcccEEEEEEEEEEccccEEEEEEEcccccEEEEccccccccEEHHHHHHHHHHHHHHHHHHHHHHHHHccccHHHHHHHHHHHHHHHHHHHHHccccccHHHccEEEEEEEEEEcccccccEEEEcEEEEEEEccccEEEcEEEEEEEEcc //